Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3639735..3640395 | Replicon | chromosome |
| Accession | NZ_CP099513 | ||
| Organism | Klebsiella sp. ZYC-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NDO58_RS17125 | Protein ID | WP_154933529.1 |
| Coordinates | 3640042..3640395 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A9E1DQ94 |
| Locus tag | NDO58_RS17120 | Protein ID | WP_004132739.1 |
| Coordinates | 3639735..3640037 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDO58_RS17090 (NDO58_17060) | 3634741..3636195 | + | 1455 | WP_024359975.1 | AMP nucleosidase | - |
| NDO58_RS17100 (NDO58_17070) | 3637223..3638680 | - | 1458 | WP_004136541.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| NDO58_RS17110 (NDO58_17080) | 3639004..3639337 | - | 334 | Protein_3342 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| NDO58_RS17115 (NDO58_17085) | 3639338..3639541 | - | 204 | Protein_3343 | hypothetical protein | - |
| NDO58_RS17120 (NDO58_17090) | 3639735..3640037 | - | 303 | WP_004132739.1 | XRE family transcriptional regulator | Antitoxin |
| NDO58_RS17125 (NDO58_17095) | 3640042..3640395 | - | 354 | WP_154933529.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NDO58_RS17130 (NDO58_17100) | 3640779..3642197 | - | 1419 | WP_049085817.1 | heavy metal sensor histidine kinase | - |
| NDO58_RS17135 (NDO58_17105) | 3642197..3642865 | - | 669 | WP_004132733.1 | heavy metal response regulator transcription factor | - |
| NDO58_RS17140 (NDO58_17110) | 3643005..3643631 | + | 627 | WP_286453908.1 | hypothetical protein | - |
| NDO58_RS17145 (NDO58_17115) | 3643646..3644254 | + | 609 | WP_004132729.1 | cytochrome b/b6 domain-containing protein | - |
| NDO58_RS17150 (NDO58_17120) | 3644244..3645011 | + | 768 | WP_286453909.1 | molybdopterin-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13604.55 Da Isoelectric Point: 9.5464
>T249053 WP_154933529.1 NZ_CP099513:c3640395-3640042 [Klebsiella sp. ZYC-1]
VWMIKTTDTFERWFTSFNDTDRASVLAALLVLREKGPGLSRPYADTLRGSRYSDMKELRIQSRGEPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMLPVAEREFTNWLKTFKEKE
VWMIKTTDTFERWFTSFNDTDRASVLAALLVLREKGPGLSRPYADTLRGSRYSDMKELRIQSRGEPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMLPVAEREFTNWLKTFKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|