Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2561706..2561969 | Replicon | chromosome |
| Accession | NZ_CP099508 | ||
| Organism | Staphylococcus aureus strain S82 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | LPT18_RS12495 | Protein ID | WP_001802298.1 |
| Coordinates | 2561706..2561810 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2561805..2561969 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT18_RS12465 | 2557605..2558213 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
| LPT18_RS12470 | 2558503..2559285 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
| LPT18_RS12475 | 2559353..2560210 | + | 858 | WP_000370942.1 | HAD family hydrolase | - |
| LPT18_RS12480 | 2560340..2560432 | - | 93 | WP_000220902.1 | hypothetical protein | - |
| LPT18_RS12485 | 2560868..2561026 | - | 159 | WP_001792784.1 | hypothetical protein | - |
| LPT18_RS12490 | 2561019..2561189 | - | 171 | WP_001807897.1 | hypothetical protein | - |
| LPT18_RS12495 | 2561706..2561810 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| - | 2561805..2561969 | - | 165 | - | - | Antitoxin |
| LPT18_RS12505 | 2562308..2563399 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
| LPT18_RS12510 | 2563665..2564645 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
| LPT18_RS12515 | 2564647..2564967 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| LPT18_RS12520 | 2565119..2565784 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T249029 WP_001802298.1 NZ_CP099508:2561706-2561810 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT249029 NZ_CP099508:c2561969-2561805 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|