Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2265861..2266045 | Replicon | chromosome |
| Accession | NZ_CP099508 | ||
| Organism | Staphylococcus aureus strain S82 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | LPT18_RS10945 | Protein ID | WP_000482647.1 |
| Coordinates | 2265861..2265968 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2265985..2266045 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT18_RS10920 | 2261218..2261691 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
| LPT18_RS10925 | 2261814..2263025 | - | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
| LPT18_RS10930 | 2263213..2263872 | - | 660 | WP_000831300.1 | hypothetical protein | - |
| LPT18_RS10935 | 2263932..2265074 | - | 1143 | WP_001176859.1 | glycerate kinase | - |
| LPT18_RS10940 | 2265341..2265727 | + | 387 | WP_000779355.1 | flippase GtxA | - |
| LPT18_RS10945 | 2265861..2265968 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2265985..2266045 | - | 61 | - | - | Antitoxin |
| LPT18_RS10950 | 2266672..2268435 | + | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein | - |
| LPT18_RS10955 | 2268460..2270193 | + | 1734 | Protein_2124 | ABC transporter ATP-binding protein | - |
| LPT18_RS10960 | 2270424..2270591 | + | 168 | WP_001798790.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T249028 WP_000482647.1 NZ_CP099508:2265861-2265968 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT249028 NZ_CP099508:c2266045-2265985 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|