Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 18813..19151 | Replicon | chromosome |
| Accession | NZ_CP099508 | ||
| Organism | Staphylococcus aureus strain S82 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | LPT18_RS00105 | Protein ID | WP_011447039.1 |
| Coordinates | 18813..18989 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 18977..19151 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT18_RS00085 | 14048..17833 | + | 3786 | WP_096777926.1 | phage tail spike protein | - |
| LPT18_RS00090 | 17823..17975 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| LPT18_RS00095 | 18022..18309 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| LPT18_RS00100 | 18367..18663 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| LPT18_RS00105 | 18813..18989 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 18977..19151 | - | 175 | - | - | Antitoxin |
| LPT18_RS00115 | 19201..19455 | + | 255 | WP_000611512.1 | phage holin | - |
| LPT18_RS00120 | 19467..20222 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| LPT18_RS00125 | 20413..20904 | + | 492 | WP_000919350.1 | staphylokinase | - |
| LPT18_RS00130 | 21554..21889 | + | 336 | Protein_25 | SH3 domain-containing protein | - |
| LPT18_RS00135 | 21984..22433 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| LPT18_RS00140 | 23118..23468 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| LPT18_RS00145 | 23521..23781 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sak / chp / scn | 1..23468 | 23467 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T249023 WP_011447039.1 NZ_CP099508:18813-18989 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT249023 NZ_CP099508:c19151-18977 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|