249022

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2822080..2822494 Replicon chromosome
Accession NZ_CP099506
Organism Staphylococcus aureus strain 0316-H-5A

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag LPT22_RS13920 Protein ID WP_031886311.1
Coordinates 2822080..2822331 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag LPT22_RS13925 Protein ID WP_000028424.1
Coordinates 2822321..2822494 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT22_RS13865 (2817282) 2817282..2819234 + 1953 WP_001796208.1 DNA polymerase -
LPT22_RS13870 (2819247) 2819247..2819432 + 186 WP_001164628.1 DUF3113 family protein -
LPT22_RS13875 (2819432) 2819432..2819833 + 402 WP_000113981.1 PVL family protein -
LPT22_RS13880 (2819833) 2819833..2820090 + 258 WP_000111488.1 DUF3310 domain-containing protein -
LPT22_RS13885 (2820093) 2820093..2820293 + 201 WP_031796775.1 hypothetical protein -
LPT22_RS13890 (2820302) 2820302..2820550 + 249 WP_000178883.1 phi PVL orf 51-like protein -
LPT22_RS13895 (2820565) 2820565..2820771 + 207 WP_000693993.1 hypothetical protein -
LPT22_RS13900 (2820774) 2820774..2821181 + 408 WP_229360494.1 hypothetical protein -
LPT22_RS13905 (2821178) 2821178..2821372 + 195 WP_031794818.1 hypothetical protein -
LPT22_RS13910 (2821369) 2821369..2821806 + 438 WP_031796778.1 YopX family protein -
LPT22_RS13915 (2821803) 2821803..2822087 + 285 WP_031886310.1 hypothetical protein -
LPT22_RS13920 (2822080) 2822080..2822331 + 252 WP_031886311.1 DUF1024 family protein Toxin
LPT22_RS13925 (2822321) 2822321..2822494 + 174 WP_000028424.1 hypothetical protein Antitoxin
LPT22_RS13930 (2822495) 2822495..2822656 + 162 WP_000889680.1 hypothetical protein -
LPT22_RS13935 (2822671) 2822671..2823177 + 507 WP_001061834.1 dUTPase -
LPT22_RS13940 (2823214) 2823214..2823420 + 207 WP_031886312.1 DUF1381 domain-containing protein -
LPT22_RS13945 (2823417) 2823417..2823611 + 195 WP_000141184.1 hypothetical protein -
LPT22_RS13950 (2823608) 2823608..2823811 + 204 WP_001072795.1 hypothetical protein -
LPT22_RS13955 (2823804) 2823804..2823956 + 153 WP_031767608.1 transcriptional activator RinB -
LPT22_RS13960 (2824024) 2824024..2824224 + 201 WP_031886313.1 DUF1514 family protein -
LPT22_RS13965 (2824276) 2824276..2826723 + 2448 WP_031886314.1 virulence-associated E family protein -
LPT22_RS13970 (2826825) 2826825..2826929 - 105 WP_078098968.1 hypothetical protein -
LPT22_RS13975 (2827063) 2827063..2827353 + 291 WP_000665205.1 VRR-NUC domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9405.28 Da        Isoelectric Point: 3.8567

>T249022 WP_031886311.1 NZ_CP099506:2822080-2822331 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT249022 WP_000028424.1 NZ_CP099506:2822321-2822494 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References