Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
| Location | 1812267..1812465 | Replicon | chromosome |
| Accession | NZ_CP099506 | ||
| Organism | Staphylococcus aureus strain 0316-H-5A | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | LPT22_RS09075 | Protein ID | WP_001802298.1 |
| Coordinates | 1812361..1812465 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 1812267..1812305 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT22_RS09050 | 1808387..1809052 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
| LPT22_RS09055 | 1809204..1809524 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| LPT22_RS09060 | 1809526..1810506 | + | 981 | WP_031886446.1 | CDF family zinc efflux transporter CzrB | - |
| LPT22_RS09065 | 1810772..1811863 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
| LPT22_RS09070 | 1812247..1812321 | + | 75 | Protein_1747 | hypothetical protein | - |
| - | 1812267..1812305 | + | 39 | - | - | Antitoxin |
| LPT22_RS09075 | 1812361..1812465 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| LPT22_RS09080 | 1813145..1813303 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| LPT22_RS09085 | 1813961..1814818 | - | 858 | WP_000370942.1 | HAD family hydrolase | - |
| LPT22_RS09090 | 1814886..1815668 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
| LPT22_RS09095 | 1815958..1816566 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T249018 WP_001802298.1 NZ_CP099506:c1812465-1812361 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT249018 NZ_CP099506:1812267-1812305 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|