Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2861494..2861908 Replicon chromosome
Accession NZ_CP099504
Organism Staphylococcus aureus strain S36

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag LPT20_RS14210 Protein ID WP_001065099.1
Coordinates 2861494..2861745 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag LPT20_RS14215 Protein ID WP_229360060.1
Coordinates 2861735..2861908 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT20_RS14150 (LPT20_14150) 2856712..2857155 + 444 WP_103694883.1 single-stranded DNA-binding protein -
LPT20_RS14155 (LPT20_14155) 2857167..2857841 + 675 WP_000057262.1 putative HNHc nuclease -
LPT20_RS14160 (LPT20_14160) 2857838..2857987 + 150 WP_001081076.1 hypothetical protein -
LPT20_RS14165 (LPT20_14165) 2857980..2858261 - 282 WP_000414755.1 hypothetical protein -
LPT20_RS14170 (LPT20_14170) 2858327..2859097 + 771 WP_000190254.1 conserved phage C-terminal domain-containing protein -
LPT20_RS14175 (LPT20_14175) 2859107..2859886 + 780 WP_000803062.1 ATP-binding protein -
LPT20_RS14180 (LPT20_14180) 2859880..2860038 + 159 WP_000256594.1 hypothetical protein -
LPT20_RS14185 (LPT20_14185) 2860051..2860272 + 222 WP_001123669.1 DUF3269 family protein -
LPT20_RS14190 (LPT20_14190) 2860282..2860686 + 405 WP_000049798.1 DUF1064 domain-containing protein -
LPT20_RS14195 (LPT20_14195) 2860691..2860876 + 186 WP_001187236.1 DUF3113 family protein -
LPT20_RS14200 (LPT20_14200) 2860877..2861233 + 357 WP_000029366.1 SA1788 family PVL leukocidin-associated protein -
LPT20_RS14205 (LPT20_14205) 2861237..2861479 + 243 WP_000131388.1 phi PVL orf 51-like protein -
LPT20_RS14210 (LPT20_14210) 2861494..2861745 + 252 WP_001065099.1 DUF1024 family protein Toxin
LPT20_RS14215 (LPT20_14215) 2861735..2861908 + 174 WP_229360060.1 hypothetical protein Antitoxin
LPT20_RS14220 (LPT20_14220) 2861909..2862190 + 282 WP_000454994.1 hypothetical protein -
LPT20_RS14225 (LPT20_14225) 2862191..2862352 + 162 WP_000889683.1 hypothetical protein -
LPT20_RS14230 (LPT20_14230) 2862367..2862873 + 507 WP_001061834.1 dUTPase -
LPT20_RS14235 (LPT20_14235) 2862910..2863155 + 246 WP_001282074.1 hypothetical protein -
LPT20_RS14240 (LPT20_14240) 2863152..2863340 + 189 WP_000195782.1 DUF1381 domain-containing protein -
LPT20_RS14245 (LPT20_14245) 2863315..2863515 + 201 WP_001125015.1 hypothetical protein -
LPT20_RS14250 (LPT20_14250) 2863518..2863667 + 150 WP_000237868.1 transcriptional activator RinB -
LPT20_RS14255 (LPT20_14255) 2863826..2864476 + 651 WP_001005262.1 hypothetical protein -
LPT20_RS14260 (LPT20_14260) 2864476..2864676 + 201 WP_000265043.1 DUF1514 family protein -
LPT20_RS14265 (LPT20_14265) 2864704..2865120 + 417 WP_000590122.1 hypothetical protein -
LPT20_RS14270 (LPT20_14270) 2865352..2865651 + 300 WP_000988330.1 HNH endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2844275..2865651 21376


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9376.32 Da        Isoelectric Point: 3.8364

>T249009 WP_001065099.1 NZ_CP099504:2861494-2861745 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILKGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6454.26 Da        Isoelectric Point: 4.2484

>AT249009 WP_229360060.1 NZ_CP099504:2861735-2861908 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQVVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References