Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2209396..2209675 | Replicon | chromosome |
Accession | NZ_CP099504 | ||
Organism | Staphylococcus aureus strain S36 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | LPT20_RS10600 | Protein ID | WP_001802298.1 |
Coordinates | 2209396..2209500 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2209496..2209675 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT20_RS10570 (LPT20_10570) | 2204790..2205572 | + | 783 | WP_000908190.1 | ABC transporter ATP-binding protein | - |
LPT20_RS10575 (LPT20_10575) | 2205640..2206497 | + | 858 | WP_000370919.1 | HAD family hydrolase | - |
LPT20_RS10585 (LPT20_10585) | 2207192..2207284 | - | 93 | WP_031844941.1 | hypothetical protein | - |
LPT20_RS10590 (LPT20_10590) | 2207573..2208709 | + | 1137 | Protein_2084 | SAP domain-containing protein | - |
LPT20_RS10595 (LPT20_10595) | 2208752..2209235 | + | 484 | Protein_2085 | recombinase family protein | - |
LPT20_RS10600 (LPT20_10600) | 2209396..2209500 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 2209496..2209675 | - | 180 | - | - | Antitoxin |
LPT20_RS10610 (LPT20_10610) | 2209949..2211040 | - | 1092 | WP_000495695.1 | hypothetical protein | - |
LPT20_RS10615 (LPT20_10615) | 2211306..2212283 | - | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
LPT20_RS10620 (LPT20_10620) | 2212285..2212605 | - | 321 | WP_000139802.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
LPT20_RS10625 (LPT20_10625) | 2212757..2213422 | + | 666 | WP_001024088.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T249003 WP_001802298.1 NZ_CP099504:2209396-2209500 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT249003 NZ_CP099504:c2209675-2209496 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|