Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2209396..2209659 | Replicon | chromosome |
| Accession | NZ_CP099504 | ||
| Organism | Staphylococcus aureus strain S36 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | LPT20_RS10600 | Protein ID | WP_001802298.1 |
| Coordinates | 2209396..2209500 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF2 | ||
| Locus tag | - | ||
| Coordinates | 2209495..2209659 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT20_RS10570 (LPT20_10570) | 2204790..2205572 | + | 783 | WP_000908190.1 | ABC transporter ATP-binding protein | - |
| LPT20_RS10575 (LPT20_10575) | 2205640..2206497 | + | 858 | WP_000370919.1 | HAD family hydrolase | - |
| LPT20_RS10585 (LPT20_10585) | 2207192..2207284 | - | 93 | WP_031844941.1 | hypothetical protein | - |
| LPT20_RS10590 (LPT20_10590) | 2207573..2208709 | + | 1137 | Protein_2084 | SAP domain-containing protein | - |
| LPT20_RS10595 (LPT20_10595) | 2208752..2209235 | + | 484 | Protein_2085 | recombinase family protein | - |
| LPT20_RS10600 (LPT20_10600) | 2209396..2209500 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| - | 2209495..2209659 | - | 165 | - | - | Antitoxin |
| LPT20_RS10610 (LPT20_10610) | 2209949..2211040 | - | 1092 | WP_000495695.1 | hypothetical protein | - |
| LPT20_RS10615 (LPT20_10615) | 2211306..2212283 | - | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
| LPT20_RS10620 (LPT20_10620) | 2212285..2212605 | - | 321 | WP_000139802.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| LPT20_RS10625 (LPT20_10625) | 2212757..2213422 | + | 666 | WP_001024088.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T249002 WP_001802298.1 NZ_CP099504:2209396-2209500 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT249002 NZ_CP099504:c2209659-2209495 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|