Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1922690..1922874 | Replicon | chromosome |
Accession | NZ_CP099504 | ||
Organism | Staphylococcus aureus strain S36 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | LPT20_RS09110 | Protein ID | WP_000482647.1 |
Coordinates | 1922690..1922797 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1922814..1922874 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT20_RS09085 (LPT20_09085) | 1918052..1918525 | + | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
LPT20_RS09090 (LPT20_09090) | 1918648..1919859 | - | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
LPT20_RS09095 (LPT20_09095) | 1920042..1920701 | - | 660 | WP_000831298.1 | membrane protein | - |
LPT20_RS09100 (LPT20_09100) | 1920761..1921903 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
LPT20_RS09105 (LPT20_09105) | 1922171..1922557 | + | 387 | WP_000779353.1 | flippase GtxA | - |
LPT20_RS09110 (LPT20_09110) | 1922690..1922797 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1922814..1922874 | - | 61 | - | - | Antitoxin |
LPT20_RS09115 (LPT20_09115) | 1922824..1922991 | + | 168 | WP_000301893.1 | hypothetical protein | - |
LPT20_RS09120 (LPT20_09120) | 1923445..1925157 | + | 1713 | WP_001064821.1 | ABC transporter ATP-binding protein | - |
LPT20_RS09125 (LPT20_09125) | 1925233..1926966 | + | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein | - |
LPT20_RS09130 (LPT20_09130) | 1927197..1927364 | + | 168 | WP_031845053.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T249000 WP_000482647.1 NZ_CP099504:1922690-1922797 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT249000 NZ_CP099504:c1922874-1922814 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|