248985

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2793534..2793948 Replicon chromosome
Accession NZ_CP099499
Organism Staphylococcus aureus strain 0610-H-2A

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag LPT19_RS13655 Protein ID WP_031883898.1
Coordinates 2793534..2793785 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag LPT19_RS13660 Protein ID WP_000028424.1
Coordinates 2793775..2793948 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT19_RS13600 (LPT19_13600) 2788736..2790688 + 1953 WP_078055733.1 DNA polymerase -
LPT19_RS13605 (LPT19_13605) 2790701..2790886 + 186 WP_001164628.1 DUF3113 family protein -
LPT19_RS13610 (LPT19_13610) 2790886..2791287 + 402 WP_000113981.1 PVL family protein -
LPT19_RS13615 (LPT19_13615) 2791287..2791544 + 258 WP_000111488.1 DUF3310 domain-containing protein -
LPT19_RS13620 (LPT19_13620) 2791547..2791747 + 201 WP_031796775.1 hypothetical protein -
LPT19_RS13625 (LPT19_13625) 2791756..2792004 + 249 WP_000178883.1 phi PVL orf 51-like protein -
LPT19_RS13630 (LPT19_13630) 2792019..2792225 + 207 WP_000693993.1 hypothetical protein -
LPT19_RS13635 (LPT19_13635) 2792228..2792635 + 408 WP_000695771.1 hypothetical protein -
LPT19_RS13640 (LPT19_13640) 2792632..2792826 + 195 WP_031794818.1 hypothetical protein -
LPT19_RS13645 (LPT19_13645) 2792823..2793260 + 438 WP_031796778.1 YopX family protein -
LPT19_RS13650 (LPT19_13650) 2793257..2793541 + 285 WP_031883897.1 hypothetical protein -
LPT19_RS13655 (LPT19_13655) 2793534..2793785 + 252 WP_031883898.1 DUF1024 family protein Toxin
LPT19_RS13660 (LPT19_13660) 2793775..2793948 + 174 WP_000028424.1 hypothetical protein Antitoxin
LPT19_RS13665 (LPT19_13665) 2793949..2794230 + 282 WP_000454994.1 hypothetical protein -
LPT19_RS13670 (LPT19_13670) 2794231..2794392 + 162 WP_180991751.1 hypothetical protein -
LPT19_RS13675 (LPT19_13675) 2794407..2794934 + 528 WP_031883899.1 dUTPase -
LPT19_RS13680 (LPT19_13680) 2794971..2795177 + 207 WP_000195812.1 DUF1381 domain-containing protein -
LPT19_RS13685 (LPT19_13685) 2795174..2795560 + 387 WP_000592219.1 hypothetical protein -
LPT19_RS13690 (LPT19_13690) 2795557..2795709 + 153 WP_000595263.1 transcriptional activator RinB -
LPT19_RS13695 (LPT19_13695) 2795777..2795977 + 201 WP_000265258.1 DUF1514 family protein -
LPT19_RS13700 (LPT19_13700) 2796029..2798476 + 2448 WP_031883900.1 virulence-associated E family protein -
LPT19_RS13705 (LPT19_13705) 2798578..2798682 - 105 WP_078098968.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2779402..2801808 22406
- inside Prophage - geh 2774846..2801808 26962


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9364.22 Da        Isoelectric Point: 3.6767

>T248985 WP_031883898.1 NZ_CP099499:2793534-2793785 [Staphylococcus aureus]
MDNREQIEQSVISASAYNGNDTEGLLKEVEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT248985 WP_000028424.1 NZ_CP099499:2793775-2793948 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References