Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2064518..2064702 | Replicon | chromosome |
Accession | NZ_CP099499 | ||
Organism | Staphylococcus aureus strain 0610-H-2A |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | LPT19_RS10280 | Protein ID | WP_000482647.1 |
Coordinates | 2064595..2064702 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2064518..2064578 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT19_RS10265 (LPT19_10265) | 2059972..2060139 | - | 168 | WP_001798790.1 | hypothetical protein | - |
LPT19_RS10270 (LPT19_10270) | 2060370..2062103 | - | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein | - |
LPT19_RS10275 (LPT19_10275) | 2062128..2063891 | - | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein | - |
- | 2064518..2064578 | + | 61 | - | - | Antitoxin |
LPT19_RS10280 (LPT19_10280) | 2064595..2064702 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
LPT19_RS10285 (LPT19_10285) | 2064836..2065222 | - | 387 | WP_000779355.1 | flippase GtxA | - |
LPT19_RS10290 (LPT19_10290) | 2065489..2066631 | + | 1143 | WP_001176859.1 | glycerate kinase | - |
LPT19_RS10295 (LPT19_10295) | 2066691..2067350 | + | 660 | WP_000831300.1 | hypothetical protein | - |
LPT19_RS10300 (LPT19_10300) | 2067538..2068749 | + | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
LPT19_RS10305 (LPT19_10305) | 2068872..2069345 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T248982 WP_000482647.1 NZ_CP099499:c2064702-2064595 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT248982 NZ_CP099499:2064518-2064578 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|