Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 1768779..1768977 | Replicon | chromosome |
Accession | NZ_CP099499 | ||
Organism | Staphylococcus aureus strain 0610-H-2A |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | LPT19_RS08730 | Protein ID | WP_001802298.1 |
Coordinates | 1768873..1768977 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1768779..1768817 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT19_RS08705 (LPT19_08705) | 1764899..1765564 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
LPT19_RS08710 (LPT19_08710) | 1765716..1766036 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
LPT19_RS08715 (LPT19_08715) | 1766038..1767018 | + | 981 | WP_031886446.1 | CDF family zinc efflux transporter CzrB | - |
LPT19_RS08720 (LPT19_08720) | 1767284..1768375 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
LPT19_RS08725 (LPT19_08725) | 1768759..1768833 | + | 75 | Protein_1676 | hypothetical protein | - |
- | 1768779..1768817 | + | 39 | - | - | Antitoxin |
LPT19_RS08730 (LPT19_08730) | 1768873..1768977 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
LPT19_RS08735 (LPT19_08735) | 1769657..1769815 | + | 159 | WP_001792784.1 | hypothetical protein | - |
LPT19_RS08740 (LPT19_08740) | 1770251..1770343 | + | 93 | WP_000220902.1 | hypothetical protein | - |
LPT19_RS08745 (LPT19_08745) | 1770473..1771330 | - | 858 | WP_000370942.1 | HAD family hydrolase | - |
LPT19_RS08750 (LPT19_08750) | 1771398..1772180 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
LPT19_RS08755 (LPT19_08755) | 1772470..1773078 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T248981 WP_001802298.1 NZ_CP099499:c1768977-1768873 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT248981 NZ_CP099499:1768779-1768817 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|