Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) SprG3-SprA2AS/-
Location 1768779..1768977 Replicon chromosome
Accession NZ_CP099499
Organism Staphylococcus aureus strain 0610-H-2A

Toxin (Protein)


Gene name SprG3 Uniprot ID Q2FWA7
Locus tag LPT19_RS08730 Protein ID WP_001802298.1
Coordinates 1768873..1768977 (-) Length 35 a.a.

Antitoxin (RNA)


Gene name SprA2AS
Locus tag -
Coordinates 1768779..1768817 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT19_RS08705 (LPT19_08705) 1764899..1765564 - 666 WP_001024099.1 SDR family oxidoreductase -
LPT19_RS08710 (LPT19_08710) 1765716..1766036 + 321 WP_000003759.1 Zn(II)-responsive metalloregulatory transcriptional repressor CzrA -
LPT19_RS08715 (LPT19_08715) 1766038..1767018 + 981 WP_031886446.1 CDF family zinc efflux transporter CzrB -
LPT19_RS08720 (LPT19_08720) 1767284..1768375 + 1092 WP_000495673.1 hypothetical protein -
LPT19_RS08725 (LPT19_08725) 1768759..1768833 + 75 Protein_1676 hypothetical protein -
- 1768779..1768817 + 39 - - Antitoxin
LPT19_RS08730 (LPT19_08730) 1768873..1768977 - 105 WP_001802298.1 hypothetical protein Toxin
LPT19_RS08735 (LPT19_08735) 1769657..1769815 + 159 WP_001792784.1 hypothetical protein -
LPT19_RS08740 (LPT19_08740) 1770251..1770343 + 93 WP_000220902.1 hypothetical protein -
LPT19_RS08745 (LPT19_08745) 1770473..1771330 - 858 WP_000370942.1 HAD family hydrolase -
LPT19_RS08750 (LPT19_08750) 1771398..1772180 - 783 WP_000908191.1 ABC transporter ATP-binding protein -
LPT19_RS08755 (LPT19_08755) 1772470..1773078 - 609 WP_000101714.1 TIR domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 35 a.a.        Molecular weight: 3906.77 Da        Isoelectric Point: 5.5724

>T248981 WP_001802298.1 NZ_CP099499:c1768977-1768873 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK

Download         Length: 105 bp

Antitoxin


Download         Length: 39 bp

>AT248981 NZ_CP099499:1768779-1768817 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y9L9

Antitoxin

Download structure file

References