Detailed information of TA system TA248976

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/-
• Location: 2798515..2798929
• Replicon: chromosome
• Accession: NZ_CP099497
• Organism: Staphylococcus aureus strain 0213-M-4A

Toxin (Protein)

• Gene name: higB
• Uniprot ID: -
• Locus tag: LPT21_RS13645
• Protein ID: WP_031886311.1
• Coordinates: 2798515..2798766 (+)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: LPT21_RS13650
• Protein ID: WP_000028424.1
• Coordinates: 2798756..2798929 (+)
• Length: 58 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LPT21_RS13590 (LPT21_13590)	2793717..2795669	+	1953	WP_001796208.1	DNA polymerase	-
LPT21_RS13595 (LPT21_13595)	2795682..2795867	+	186	WP_001164628.1	DUF3113 family protein	-
LPT21_RS13600 (LPT21_13600)	2795867..2796268	+	402	WP_000113981.1	PVL family protein	-
LPT21_RS13605 (LPT21_13605)	2796268..2796525	+	258	WP_000111488.1	DUF3310 domain-containing protein	-
LPT21_RS13610 (LPT21_13610)	2796528..2796728	+	201	WP_031796775.1	hypothetical protein	-
LPT21_RS13615 (LPT21_13615)	2796737..2796985	+	249	WP_000178883.1	phi PVL orf 51-like protein	-
LPT21_RS13620 (LPT21_13620)	2797000..2797206	+	207	WP_000693993.1	hypothetical protein	-
LPT21_RS13625 (LPT21_13625)	2797209..2797616	+	408	WP_000695771.1	hypothetical protein	-
LPT21_RS13630 (LPT21_13630)	2797613..2797807	+	195	WP_031794818.1	hypothetical protein	-
LPT21_RS13635 (LPT21_13635)	2797804..2798241	+	438	WP_031796778.1	YopX family protein	-
LPT21_RS13640 (LPT21_13640)	2798238..2798522	+	285	WP_031886310.1	hypothetical protein	-
LPT21_RS13645 (LPT21_13645)	2798515..2798766	+	252	WP_031886311.1	DUF1024 family protein	Toxin
LPT21_RS13650 (LPT21_13650)	2798756..2798929	+	174	WP_000028424.1	hypothetical protein	Antitoxin
LPT21_RS13655 (LPT21_13655)	2798930..2799091	+	162	WP_000889680.1	hypothetical protein	-
LPT21_RS13660 (LPT21_13660)	2799106..2799612	+	507	WP_001061834.1	dUTPase	-
LPT21_RS13665 (LPT21_13665)	2799649..2799855	+	207	WP_031886312.1	DUF1381 domain-containing protein	-
LPT21_RS13670 (LPT21_13670)	2799852..2800046	+	195	WP_000141184.1	hypothetical protein	-
LPT21_RS13675 (LPT21_13675)	2800043..2800246	+	204	WP_001072795.1	hypothetical protein	-
LPT21_RS13680 (LPT21_13680)	2800239..2800391	+	153	WP_031767608.1	transcriptional activator RinB	-
LPT21_RS13685 (LPT21_13685)	2800459..2800659	+	201	WP_031886313.1	DUF1514 family protein	-
LPT21_RS13690 (LPT21_13690)	2800711..2803158	+	2448	WP_031886314.1	virulence-associated E family protein	-
LPT21_RS13695 (LPT21_13695)	2803260..2803364	-	105	WP_078098968.1	hypothetical protein	-
LPT21_RS13700 (LPT21_13700)	2803498..2803788	+	291	WP_000665205.1	VRR-NUC domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	2785556..2806490	20934

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF1024 (1-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9405.28 Da
• Isoelectric Point: 3.8567

>T248976 WP_031886311.1 NZ_CP099497:2798515-2798766 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMTGQVVYKYEEEQE
NEY

Nucleotide

• Length: 252 bp

Antitoxin

Protein

• Length: 58 a.a.
• Molecular weight: 6468.29 Da
• Isoelectric Point: 4.2484

>AT248976 WP_000028424.1 NZ_CP099497:2798756-2798929 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Nucleotide

• Length: 174 bp