Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2070561..2070745 | Replicon | chromosome |
Accession | NZ_CP099497 | ||
Organism | Staphylococcus aureus strain 0213-M-4A |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | LPT21_RS10290 | Protein ID | WP_000482647.1 |
Coordinates | 2070638..2070745 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2070561..2070621 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT21_RS10275 (LPT21_10275) | 2066015..2066182 | - | 168 | WP_001798790.1 | hypothetical protein | - |
LPT21_RS10280 (LPT21_10280) | 2066413..2068146 | - | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein | - |
LPT21_RS10285 (LPT21_10285) | 2068171..2069934 | - | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein | - |
- | 2070561..2070621 | + | 61 | - | - | Antitoxin |
LPT21_RS10290 (LPT21_10290) | 2070638..2070745 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
LPT21_RS10295 (LPT21_10295) | 2070879..2071265 | - | 387 | WP_000779355.1 | flippase GtxA | - |
LPT21_RS10300 (LPT21_10300) | 2071532..2072674 | + | 1143 | WP_001176859.1 | glycerate kinase | - |
LPT21_RS10305 (LPT21_10305) | 2072734..2073393 | + | 660 | WP_000831300.1 | hypothetical protein | - |
LPT21_RS10310 (LPT21_10310) | 2073581..2074792 | + | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
LPT21_RS10315 (LPT21_10315) | 2074915..2075388 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T248973 WP_000482647.1 NZ_CP099497:c2070745-2070638 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT248973 NZ_CP099497:2070561-2070621 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|