Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2559901..2560164 | Replicon | chromosome |
Accession | NZ_CP099495 | ||
Organism | Staphylococcus aureus strain JL28 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | LPT16_RS12495 | Protein ID | WP_001802298.1 |
Coordinates | 2559901..2560005 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2560000..2560164 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT16_RS12470 | 2555800..2556408 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
LPT16_RS12475 | 2556698..2557480 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
LPT16_RS12480 | 2557548..2558405 | + | 858 | WP_000370942.1 | HAD family hydrolase | - |
LPT16_RS12485 | 2558535..2558627 | - | 93 | WP_000220902.1 | hypothetical protein | - |
LPT16_RS12490 | 2559063..2559221 | - | 159 | WP_001792784.1 | hypothetical protein | - |
LPT16_RS12495 | 2559901..2560005 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 2560000..2560164 | - | 165 | - | - | Antitoxin |
LPT16_RS12505 | 2560503..2561594 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
LPT16_RS12510 | 2561860..2562840 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
LPT16_RS12515 | 2562842..2563162 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
LPT16_RS12520 | 2563314..2563979 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T248963 WP_001802298.1 NZ_CP099495:2559901-2560005 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT248963 NZ_CP099495:c2560164-2560000 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|