Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2263988..2264172 | Replicon | chromosome |
Accession | NZ_CP099495 | ||
Organism | Staphylococcus aureus strain JL28 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | LPT16_RS10950 | Protein ID | WP_000482647.1 |
Coordinates | 2263988..2264095 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2264112..2264172 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT16_RS10925 | 2259345..2259818 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
LPT16_RS10930 | 2259941..2261152 | - | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
LPT16_RS10935 | 2261340..2261999 | - | 660 | WP_000831300.1 | hypothetical protein | - |
LPT16_RS10940 | 2262059..2263201 | - | 1143 | WP_001176859.1 | glycerate kinase | - |
LPT16_RS10945 | 2263468..2263854 | + | 387 | WP_000779355.1 | flippase GtxA | - |
LPT16_RS10950 | 2263988..2264095 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2264112..2264172 | - | 61 | - | - | Antitoxin |
LPT16_RS10955 | 2264799..2266562 | + | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein | - |
LPT16_RS10960 | 2266587..2268320 | + | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein | - |
LPT16_RS10965 | 2268551..2268718 | + | 168 | WP_001798790.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T248962 WP_000482647.1 NZ_CP099495:2263988-2264095 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT248962 NZ_CP099495:c2264172-2264112 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|