Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 18813..19120 | Replicon | chromosome |
| Accession | NZ_CP099495 | ||
| Organism | Staphylococcus aureus strain JL28 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | LPT16_RS00105 | Protein ID | WP_011447039.1 |
| Coordinates | 18813..18989 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 18981..19120 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT16_RS00085 (14048) | 14048..17833 | + | 3786 | WP_096777926.1 | phage tail spike protein | - |
| LPT16_RS00090 (17823) | 17823..17975 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| LPT16_RS00095 (18022) | 18022..18309 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| LPT16_RS00100 (18367) | 18367..18663 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| LPT16_RS00105 (18813) | 18813..18989 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (18981) | 18981..19120 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (18981) | 18981..19120 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (18981) | 18981..19120 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (18981) | 18981..19120 | - | 140 | NuclAT_0 | - | Antitoxin |
| LPT16_RS00110 (19042) | 19042..19149 | - | 108 | WP_001791821.1 | hypothetical protein | - |
| LPT16_RS00115 (19201) | 19201..19455 | + | 255 | WP_000611512.1 | phage holin | - |
| LPT16_RS00120 (19467) | 19467..20222 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| LPT16_RS00125 (20413) | 20413..20904 | + | 492 | WP_000919350.1 | staphylokinase | - |
| LPT16_RS00130 (21554) | 21554..21889 | + | 336 | Protein_25 | SH3 domain-containing protein | - |
| LPT16_RS00135 (21984) | 21984..22433 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| LPT16_RS00140 (23118) | 23118..23468 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| LPT16_RS00145 (23521) | 23521..23781 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sak / chp / scn | 1..23468 | 23467 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T248959 WP_011447039.1 NZ_CP099495:18813-18989 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT248959 NZ_CP099495:c19120-18981 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
