Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4543634..4544295 | Replicon | chromosome |
| Accession | NZ_CP099489 | ||
| Organism | Ornithinimicrobium sp. HY1793 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | NF556_RS20985 | Protein ID | WP_252593291.1 |
| Coordinates | 4543945..4544295 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | NF556_RS20980 | Protein ID | WP_252593289.1 |
| Coordinates | 4543634..4543939 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF556_RS20955 (NF556_20955) | 4539449..4540150 | - | 702 | WP_252593279.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
| NF556_RS20960 (NF556_20960) | 4540183..4540365 | - | 183 | WP_252593280.1 | hypothetical protein | - |
| NF556_RS20965 (NF556_20965) | 4540459..4541241 | + | 783 | WP_252593283.1 | class I SAM-dependent methyltransferase | - |
| NF556_RS20970 (NF556_20970) | 4541285..4542079 | + | 795 | WP_252593284.1 | VOC family protein | - |
| NF556_RS20975 (NF556_20975) | 4542827..4543252 | + | 426 | WP_252593287.1 | hypothetical protein | - |
| NF556_RS20980 (NF556_20980) | 4543634..4543939 | - | 306 | WP_252593289.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NF556_RS20985 (NF556_20985) | 4543945..4544295 | - | 351 | WP_252593291.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NF556_RS20990 (NF556_20990) | 4545282..4545884 | + | 603 | WP_252593293.1 | hypothetical protein | - |
| NF556_RS20995 (NF556_20995) | 4545975..4546769 | - | 795 | WP_252593295.1 | class I SAM-dependent methyltransferase | - |
| NF556_RS21000 (NF556_21000) | 4547153..4547410 | - | 258 | WP_252593297.1 | hypothetical protein | - |
| NF556_RS21005 (NF556_21005) | 4547565..4547813 | + | 249 | WP_252593299.1 | hypothetical protein | - |
| NF556_RS21010 (NF556_21010) | 4547967..4548500 | - | 534 | WP_252593301.1 | GrpB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13338.16 Da Isoelectric Point: 5.7628
>T248943 WP_252593291.1 NZ_CP099489:c4544295-4543945 [Ornithinimicrobium sp. HY1793]
MWSVDIELIAEWLASLDQGSQEQVVAAMELLEDRGPQLGRPVVDTVSRSRHRNMKELRPGSSGRSELRILFAFDPERQAI
LLLAGDKAGNWQRWYKKNIPLADNLFDEHLRRLEGQ
MWSVDIELIAEWLASLDQGSQEQVVAAMELLEDRGPQLGRPVVDTVSRSRHRNMKELRPGSSGRSELRILFAFDPERQAI
LLLAGDKAGNWQRWYKKNIPLADNLFDEHLRRLEGQ
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|