Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
Location | 496751..497282 | Replicon | chromosome |
Accession | NZ_CP099481 | ||
Organism | Companilactobacillus allii strain WiKim39 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | - |
Locus tag | M5C72_RS02375 | Protein ID | WP_076614513.1 |
Coordinates | 496998..497282 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | M5C72_RS02370 | Protein ID | WP_076614512.1 |
Coordinates | 496751..497005 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5C72_RS02350 (M5C72_02350) | 492184..493470 | + | 1287 | WP_225972244.1 | Fe-S cluster assembly protein SufD | - |
M5C72_RS02355 (M5C72_02355) | 493457..494674 | + | 1218 | WP_076614509.1 | cysteine desulfurase | - |
M5C72_RS02360 (M5C72_02360) | 494661..495098 | + | 438 | WP_076614510.1 | SUF system NifU family Fe-S cluster assembly protein | - |
M5C72_RS02365 (M5C72_02365) | 495112..496554 | + | 1443 | WP_076614511.1 | Fe-S cluster assembly protein SufB | - |
M5C72_RS02370 (M5C72_02370) | 496751..497005 | + | 255 | WP_076614512.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5C72_RS02375 (M5C72_02375) | 496998..497282 | + | 285 | WP_076614513.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
M5C72_RS02380 (M5C72_02380) | 497506..499842 | - | 2337 | WP_076614514.1 | HAD-IC family P-type ATPase | - |
M5C72_RS02385 (M5C72_02385) | 499922..500584 | + | 663 | WP_076614515.1 | HAD hydrolase-like protein | - |
M5C72_RS02390 (M5C72_02390) | 500591..501409 | + | 819 | WP_076614516.1 | hypothetical protein | - |
M5C72_RS02395 (M5C72_02395) | 501425..501790 | + | 366 | WP_076614517.1 | iron-sulfur cluster biosynthesis family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11052.17 Da Isoelectric Point: 10.6282
>T248937 WP_076614513.1 NZ_CP099481:496998-497282 [Companilactobacillus allii]
MLEIVQTPTFVKDFKKLKKKHYNMLLLKKVVTHIVKGENEILVSKYRDHALKGNWQGFREVHIEKDWLLVYLVNKGELRL
ALIRTGSHSQILGK
MLEIVQTPTFVKDFKKLKKKHYNMLLLKKVVTHIVKGENEILVSKYRDHALKGNWQGFREVHIEKDWLLVYLVNKGELRL
ALIRTGSHSQILGK
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|