Detailed information of TA system TA248903

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 37144..37413
• Replicon: plasmid pSKLX33367_KPC2
• Accession: NZ_CP099415
• Organism: Klebsiella pneumoniae strain 33367

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NE847_RS28450
• Protein ID: WP_001372321.1
• Coordinates: 37288..37413 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	37144..37209 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NE847_RS28420	32854..33381	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
NE847_RS28425	33439..33672	+	234	WP_000006003.1	DUF905 family protein	-
NE847_RS28430	33733..35756	+	2024	Protein_45	ParB/RepB/Spo0J family partition protein	-
NE847_RS28435	35825..36259	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NE847_RS28440	36256..36975	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	36987..37211	+	225	NuclAT_0	-	-
-	36987..37211	+	225	NuclAT_0	-	-
-	36987..37211	+	225	NuclAT_0	-	-
-	36987..37211	+	225	NuclAT_0	-	-
-	37144..37209	-	66	-	-	Antitoxin
NE847_RS28445	37197..37346	+	150	Protein_48	plasmid maintenance protein Mok	-
NE847_RS28450	37288..37413	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NE847_RS28455	37732..38028	-	297	Protein_50	hypothetical protein	-
NE847_RS28460	38328..38624	+	297	WP_001272251.1	hypothetical protein	-
NE847_RS28465	38735..39556	+	822	WP_001234445.1	DUF932 domain-containing protein	-
NE847_RS28470	39853..40500	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
NE847_RS28475	40777..41160	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NE847_RS28480	41351..42037	+	687	WP_015059009.1	PAS domain-containing protein	-
NE847_RS28485	42131..42358	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2	-	1..150096	150096

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T248903 WP_001372321.1 NZ_CP099415:37288-37413 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT248903 NZ_CP099415:c37209-37144 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin