Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 60067..60794 | Replicon | plasmid pSKLX33367_VIR |
| Accession | NZ_CP099414 | ||
| Organism | Klebsiella pneumoniae strain 33367 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | NE847_RS27325 | Protein ID | WP_011251285.1 |
| Coordinates | 60483..60794 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NE847_RS27320 | Protein ID | WP_011251286.1 |
| Coordinates | 60067..60486 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NE847_RS27290 (NE847_27290) | 55235..55705 | - | 471 | WP_048333570.1 | hypothetical protein | - |
| NE847_RS27295 (NE847_27295) | 56018..56653 | - | 636 | WP_223171879.1 | hypothetical protein | - |
| NE847_RS27300 (NE847_27300) | 57072..57692 | + | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| NE847_RS27305 (NE847_27305) | 57713..58501 | + | 789 | WP_040217257.1 | hypothetical protein | - |
| NE847_RS27310 (NE847_27310) | 58515..58880 | + | 366 | WP_048333448.1 | hypothetical protein | - |
| NE847_RS27315 (NE847_27315) | 58952..59920 | - | 969 | WP_074428168.1 | IS5 family transposase | - |
| NE847_RS27320 (NE847_27320) | 60067..60486 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NE847_RS27325 (NE847_27325) | 60483..60794 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NE847_RS27330 (NE847_27330) | 60999..61436 | - | 438 | Protein_60 | DDE-type integrase/transposase/recombinase | - |
| NE847_RS27335 (NE847_27335) | 61571..62268 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| NE847_RS27340 (NE847_27340) | 62270..62719 | + | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| NE847_RS27345 (NE847_27345) | 62736..63047 | + | 312 | WP_011251282.1 | hypothetical protein | - |
| NE847_RS27350 (NE847_27350) | 63061..63402 | + | 342 | WP_011251281.1 | hypothetical protein | - |
| NE847_RS27355 (NE847_27355) | 63462..64418 | + | 957 | WP_011251280.1 | DsbA family protein | - |
| NE847_RS27360 (NE847_27360) | 64843..65283 | - | 441 | WP_011251275.1 | hypothetical protein | - |
| NE847_RS27365 (NE847_27365) | 65289..65783 | - | 495 | WP_011251274.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..215836 | 215836 | |
| - | inside | IScluster/Tn | - | - | 43396..67703 | 24307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T248899 WP_011251285.1 NZ_CP099414:c60794-60483 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT248899 WP_011251286.1 NZ_CP099414:c60486-60067 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|