Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 60067..60794 Replicon plasmid pSKLX33367_VIR
Accession NZ_CP099414
Organism Klebsiella pneumoniae strain 33367

Toxin (Protein)


Gene name higB Uniprot ID A0A7W3D9W1
Locus tag NE847_RS27325 Protein ID WP_011251285.1
Coordinates 60483..60794 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NE847_RS27320 Protein ID WP_011251286.1
Coordinates 60067..60486 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE847_RS27290 (NE847_27290) 55235..55705 - 471 WP_048333570.1 hypothetical protein -
NE847_RS27295 (NE847_27295) 56018..56653 - 636 WP_223171879.1 hypothetical protein -
NE847_RS27300 (NE847_27300) 57072..57692 + 621 WP_223175004.1 conjugative transfer protein MobI(A/C) -
NE847_RS27305 (NE847_27305) 57713..58501 + 789 WP_040217257.1 hypothetical protein -
NE847_RS27310 (NE847_27310) 58515..58880 + 366 WP_048333448.1 hypothetical protein -
NE847_RS27315 (NE847_27315) 58952..59920 - 969 WP_074428168.1 IS5 family transposase -
NE847_RS27320 (NE847_27320) 60067..60486 - 420 WP_011251286.1 helix-turn-helix domain-containing protein Antitoxin
NE847_RS27325 (NE847_27325) 60483..60794 - 312 WP_011251285.1 type II toxin-antitoxin system HigB family toxin Toxin
NE847_RS27330 (NE847_27330) 60999..61436 - 438 Protein_60 DDE-type integrase/transposase/recombinase -
NE847_RS27335 (NE847_27335) 61571..62268 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
NE847_RS27340 (NE847_27340) 62270..62719 + 450 WP_011251283.1 thioredoxin fold domain-containing protein -
NE847_RS27345 (NE847_27345) 62736..63047 + 312 WP_011251282.1 hypothetical protein -
NE847_RS27350 (NE847_27350) 63061..63402 + 342 WP_011251281.1 hypothetical protein -
NE847_RS27355 (NE847_27355) 63462..64418 + 957 WP_011251280.1 DsbA family protein -
NE847_RS27360 (NE847_27360) 64843..65283 - 441 WP_011251275.1 hypothetical protein -
NE847_RS27365 (NE847_27365) 65289..65783 - 495 WP_011251274.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..215836 215836
- inside IScluster/Tn - - 43396..67703 24307


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(22-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(85-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12346.12 Da        Isoelectric Point: 9.7248

>T248899 WP_011251285.1 NZ_CP099414:c60794-60483 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15377.46 Da        Isoelectric Point: 4.4420

>AT248899 WP_011251286.1 NZ_CP099414:c60486-60067 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W3D9W1

Antitoxin

Source ID Structure

References