Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3044594..3045243 | Replicon | chromosome |
Accession | NZ_CP099397 | ||
Organism | Pseudomonas hydrolytica strain DSWY01 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | L1F06_RS14080 | Protein ID | WP_047588122.1 |
Coordinates | 3044594..3044938 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A8I0SEX5 |
Locus tag | L1F06_RS14085 | Protein ID | WP_003116648.1 |
Coordinates | 3044935..3045243 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L1F06_RS14065 (L1F06_014065) | 3040357..3042210 | + | 1854 | WP_014596887.1 | asparagine synthase (glutamine-hydrolyzing) | - |
L1F06_RS14070 (L1F06_014070) | 3042297..3043496 | + | 1200 | WP_074915921.1 | MFS transporter | - |
L1F06_RS14075 (L1F06_014075) | 3043510..3044436 | + | 927 | WP_129482275.1 | LysR family transcriptional regulator | - |
L1F06_RS14080 (L1F06_014080) | 3044594..3044938 | + | 345 | WP_047588122.1 | toxin | Toxin |
L1F06_RS14085 (L1F06_014085) | 3044935..3045243 | + | 309 | WP_003116648.1 | transcriptional regulator | Antitoxin |
L1F06_RS14090 (L1F06_014090) | 3045630..3046499 | - | 870 | WP_003116646.1 | LysR family transcriptional regulator | - |
L1F06_RS14095 (L1F06_014095) | 3047133..3048284 | - | 1152 | WP_129482274.1 | trypsin-like peptidase domain-containing protein | - |
L1F06_RS14100 (L1F06_014100) | 3048304..3049266 | - | 963 | WP_003116644.1 | zinc metalloprotease HtpX | - |
L1F06_RS14105 (L1F06_014105) | 3049253..3049741 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
L1F06_RS14110 (L1F06_014110) | 3049783..3050001 | - | 219 | WP_043942199.1 | diguanylate cyclase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13366.33 Da Isoelectric Point: 10.2892
>T248874 WP_047588122.1 NZ_CP099397:3044594-3044938 [Pseudomonas hydrolytica]
MKALFVELSPFERNRKAHLDDDEYSLFQQMLLTNPEAGAVIANSGGLRKVRFGSVRRNKGKRGGVRVIYYYWLRGLQFWL
FTLYDKDELDDLSSDQRRQLKALLEREVKARQAP
MKALFVELSPFERNRKAHLDDDEYSLFQQMLLTNPEAGAVIANSGGLRKVRFGSVRRNKGKRGGVRVIYYYWLRGLQFWL
FTLYDKDELDDLSSDQRRQLKALLEREVKARQAP
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|