Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 43316..43965 | Replicon | chromosome |
Accession | NZ_CP099390 | ||
Organism | Citrobacter braakii strain RHB02-E3-C05 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7L6TVT2 |
Locus tag | NFJ22_RS00205 | Protein ID | WP_016157800.1 |
Coordinates | 43316..43657 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A7L6TWH1 |
Locus tag | NFJ22_RS00210 | Protein ID | WP_016157799.1 |
Coordinates | 43666..43965 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ22_RS00190 (NFJ22_00190) | 39752..41080 | + | 1329 | WP_046276191.1 | MFS transporter | - |
NFJ22_RS00195 (NFJ22_00195) | 41223..42614 | + | 1392 | WP_003023929.1 | hexose-6-phosphate:phosphate antiporter | - |
NFJ22_RS00200 (NFJ22_00200) | 42763..43215 | + | 453 | WP_016157801.1 | DUF1198 family protein | - |
NFJ22_RS00205 (NFJ22_00205) | 43316..43657 | + | 342 | WP_016157800.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ22_RS00210 (NFJ22_00210) | 43666..43965 | + | 300 | WP_016157799.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NFJ22_RS00215 (NFJ22_00215) | 44084..45268 | + | 1185 | WP_279263668.1 | purine ribonucleoside efflux pump NepI | - |
NFJ22_RS00220 (NFJ22_00220) | 45324..46706 | - | 1383 | WP_200046790.1 | glycoside hydrolase family 1 protein | - |
NFJ22_RS00225 (NFJ22_00225) | 46799..47092 | - | 294 | WP_047498766.1 | YicS family protein | - |
NFJ22_RS00230 (NFJ22_00230) | 47223..47639 | + | 417 | WP_016155037.1 | GNAT family N-acetyltransferase | - |
NFJ22_RS00235 (NFJ22_00235) | 47811..48629 | + | 819 | WP_049042688.1 | lipoprotein NlpA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13061.92 Da Isoelectric Point: 5.6550
>T248854 WP_016157800.1 NZ_CP099390:43316-43657 [Citrobacter braakii]
MWEVETTDVFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGNPIRAFFVFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLNK
MWEVETTDVFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGNPIRAFFVFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLNK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L6TVT2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L6TWH1 |