Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4775646..4776406 Replicon chromosome
Accession NZ_CP099389
Organism Citrobacter braakii strain RHB02-E4-C01

Toxin (Protein)


Gene name higB Uniprot ID A0A7L6U900
Locus tag NFJ24_RS22610 Protein ID WP_019077936.1
Coordinates 4775646..4775957 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NFJ24_RS22615 Protein ID WP_103767199.1
Coordinates 4775954..4776406 (+) Length 151 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ24_RS22580 (4771314) 4771314..4772216 + 903 WP_016155183.1 formate dehydrogenase O subunit beta -
NFJ24_RS22585 (4772213) 4772213..4772848 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFJ24_RS22590 (4772845) 4772845..4773774 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFJ24_RS22595 (4773811) 4773811..4774185 - 375 WP_200080372.1 type II toxin-antitoxin system VapC family toxin -
NFJ24_RS22600 (4774185) 4774185..4774427 - 243 WP_016155181.1 CopG family transcriptional regulator -
NFJ24_RS22605 (4774632) 4774632..4775561 + 930 WP_047497507.1 alpha/beta hydrolase -
NFJ24_RS22610 (4775646) 4775646..4775957 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin Toxin
NFJ24_RS22615 (4775954) 4775954..4776406 + 453 WP_103767199.1 helix-turn-helix domain-containing protein Antitoxin
NFJ24_RS22620 (4776424) 4776424..4777365 - 942 WP_049282313.1 fatty acid biosynthesis protein FabY -
NFJ24_RS22625 (4777410) 4777410..4777847 - 438 WP_003028671.1 D-aminoacyl-tRNA deacylase -
NFJ24_RS22630 (4777844) 4777844..4778716 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFJ24_RS22635 (4778710) 4778710..4779309 - 600 WP_016155174.1 glucose-1-phosphatase -
NFJ24_RS22640 (4779414) 4779414..4780217 - 804 WP_016155173.1 DeoR/GlpR family DNA-binding transcription regulator -
NFJ24_RS22645 (4780251) 4780251..4781147 - 897 WP_141876131.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(95-148)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12502.67 Da        Isoelectric Point: 9.9988

>T248853 WP_019077936.1 NZ_CP099389:4775646-4775957 [Citrobacter braakii]
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE

Download         Length: 312 bp

Antitoxin


Download         Length: 151 a.a.        Molecular weight: 17007.40 Da        Isoelectric Point: 6.1420

>AT248853 WP_103767199.1 NZ_CP099389:4775954-4776406 [Citrobacter braakii]
MRTHESHHIDTASVKLMIDTFTDAVKKIPLLGKEQNETEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE

Download         Length: 453 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6U900

Antitoxin

Source ID Structure

References