Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4775646..4776406 | Replicon | chromosome |
| Accession | NZ_CP099389 | ||
| Organism | Citrobacter braakii strain RHB02-E4-C01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7L6U900 |
| Locus tag | NFJ24_RS22610 | Protein ID | WP_019077936.1 |
| Coordinates | 4775646..4775957 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFJ24_RS22615 | Protein ID | WP_103767199.1 |
| Coordinates | 4775954..4776406 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ24_RS22580 (4771314) | 4771314..4772216 | + | 903 | WP_016155183.1 | formate dehydrogenase O subunit beta | - |
| NFJ24_RS22585 (4772213) | 4772213..4772848 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFJ24_RS22590 (4772845) | 4772845..4773774 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| NFJ24_RS22595 (4773811) | 4773811..4774185 | - | 375 | WP_200080372.1 | type II toxin-antitoxin system VapC family toxin | - |
| NFJ24_RS22600 (4774185) | 4774185..4774427 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | - |
| NFJ24_RS22605 (4774632) | 4774632..4775561 | + | 930 | WP_047497507.1 | alpha/beta hydrolase | - |
| NFJ24_RS22610 (4775646) | 4775646..4775957 | + | 312 | WP_019077936.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NFJ24_RS22615 (4775954) | 4775954..4776406 | + | 453 | WP_103767199.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NFJ24_RS22620 (4776424) | 4776424..4777365 | - | 942 | WP_049282313.1 | fatty acid biosynthesis protein FabY | - |
| NFJ24_RS22625 (4777410) | 4777410..4777847 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
| NFJ24_RS22630 (4777844) | 4777844..4778716 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
| NFJ24_RS22635 (4778710) | 4778710..4779309 | - | 600 | WP_016155174.1 | glucose-1-phosphatase | - |
| NFJ24_RS22640 (4779414) | 4779414..4780217 | - | 804 | WP_016155173.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NFJ24_RS22645 (4780251) | 4780251..4781147 | - | 897 | WP_141876131.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12502.67 Da Isoelectric Point: 9.9988
>T248853 WP_019077936.1 NZ_CP099389:4775646-4775957 [Citrobacter braakii]
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE
Download Length: 312 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 17007.40 Da Isoelectric Point: 6.1420
>AT248853 WP_103767199.1 NZ_CP099389:4775954-4776406 [Citrobacter braakii]
MRTHESHHIDTASVKLMIDTFTDAVKKIPLLGKEQNETEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
MRTHESHHIDTASVKLMIDTFTDAVKKIPLLGKEQNETEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|