Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 43317..43966 | Replicon | chromosome |
| Accession | NZ_CP099389 | ||
| Organism | Citrobacter braakii strain RHB02-E4-C01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NFJ24_RS00200 | Protein ID | WP_235116967.1 |
| Coordinates | 43317..43658 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A7L6TWH1 |
| Locus tag | NFJ24_RS00205 | Protein ID | WP_016157799.1 |
| Coordinates | 43667..43966 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ24_RS00185 (39753) | 39753..41081 | + | 1329 | WP_016155042.1 | MFS transporter | - |
| NFJ24_RS00190 (41224) | 41224..42615 | + | 1392 | WP_003023929.1 | hexose-6-phosphate:phosphate antiporter | - |
| NFJ24_RS00195 (42764) | 42764..43216 | + | 453 | WP_016157801.1 | DUF1198 family protein | - |
| NFJ24_RS00200 (43317) | 43317..43658 | + | 342 | WP_235116967.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFJ24_RS00205 (43667) | 43667..43966 | + | 300 | WP_016157799.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NFJ24_RS00210 (44085) | 44085..45269 | + | 1185 | WP_094169436.1 | purine ribonucleoside efflux pump NepI | - |
| NFJ24_RS00215 (45325) | 45325..46707 | - | 1383 | WP_016157797.1 | glycoside hydrolase family 1 protein | - |
| NFJ24_RS00220 (46800) | 46800..47093 | - | 294 | WP_019078023.1 | YicS family protein | - |
| NFJ24_RS00225 (47224) | 47224..47640 | + | 417 | WP_016155037.1 | GNAT family N-acetyltransferase | - |
| NFJ24_RS00230 (47812) | 47812..48630 | + | 819 | WP_046276188.1 | lipoprotein NlpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13060.97 Da Isoelectric Point: 5.6550
>T248843 WP_235116967.1 NZ_CP099389:43317-43658 [Citrobacter braakii]
MWEVETTDVFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVIASAFSNMKELRVQHQGNPIRAFFVFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLNK
MWEVETTDVFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVIASAFSNMKELRVQHQGNPIRAFFVFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLNK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|