Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4679772..4680532 | Replicon | chromosome |
| Accession | NZ_CP099384 | ||
| Organism | Citrobacter braakii strain RHB13-SO-C07 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7L6U900 |
| Locus tag | NFJ78_RS22100 | Protein ID | WP_019077936.1 |
| Coordinates | 4679772..4680083 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFJ78_RS22105 | Protein ID | WP_141876133.1 |
| Coordinates | 4680080..4680532 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ78_RS22070 (4675439) | 4675439..4676341 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
| NFJ78_RS22075 (4676338) | 4676338..4676973 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFJ78_RS22080 (4676970) | 4676970..4677899 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| NFJ78_RS22085 (4677936) | 4677936..4678310 | - | 375 | WP_016155182.1 | type II toxin-antitoxin system VapC family toxin | - |
| NFJ78_RS22090 (4678310) | 4678310..4678552 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | - |
| NFJ78_RS22095 (4678758) | 4678758..4679687 | + | 930 | WP_094761752.1 | alpha/beta hydrolase | - |
| NFJ78_RS22100 (4679772) | 4679772..4680083 | + | 312 | WP_019077936.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NFJ78_RS22105 (4680080) | 4680080..4680532 | + | 453 | WP_141876133.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NFJ78_RS22110 (4680550) | 4680550..4681491 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| NFJ78_RS22115 (4681536) | 4681536..4681973 | - | 438 | WP_016157874.1 | D-aminoacyl-tRNA deacylase | - |
| NFJ78_RS22120 (4681970) | 4681970..4682842 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
| NFJ78_RS22125 (4682836) | 4682836..4683435 | - | 600 | WP_016157873.1 | glucose-1-phosphatase | - |
| NFJ78_RS22130 (4683526) | 4683526..4684416 | - | 891 | WP_053388926.1 | aldose epimerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4678758..4692120 | 13362 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12502.67 Da Isoelectric Point: 9.9988
>T248797 WP_019077936.1 NZ_CP099384:4679772-4680083 [Citrobacter braakii]
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE
Download Length: 312 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16998.39 Da Isoelectric Point: 5.9259
>AT248797 WP_141876133.1 NZ_CP099384:4680080-4680532 [Citrobacter braakii]
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNETEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNETEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|