Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 35702..36351 | Replicon | chromosome |
Accession | NZ_CP099378 | ||
Organism | Citrobacter braakii strain RHB21-E1-C04 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7L6TVT2 |
Locus tag | NFK10_RS00180 | Protein ID | WP_016157800.1 |
Coordinates | 35702..36043 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A7L6TWH1 |
Locus tag | NFK10_RS00185 | Protein ID | WP_016157799.1 |
Coordinates | 36052..36351 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK10_RS00165 (32138) | 32138..33466 | + | 1329 | WP_016155042.1 | MFS transporter | - |
NFK10_RS00170 (33609) | 33609..35000 | + | 1392 | WP_003023929.1 | hexose-6-phosphate:phosphate antiporter | - |
NFK10_RS00175 (35149) | 35149..35601 | + | 453 | WP_016157801.1 | DUF1198 family protein | - |
NFK10_RS00180 (35702) | 35702..36043 | + | 342 | WP_016157800.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFK10_RS00185 (36052) | 36052..36351 | + | 300 | WP_016157799.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NFK10_RS00190 (36470) | 36470..37654 | + | 1185 | WP_016157798.1 | purine ribonucleoside efflux pump NepI | - |
NFK10_RS00195 (37710) | 37710..39092 | - | 1383 | WP_016157797.1 | glycoside hydrolase family 1 protein | - |
NFK10_RS00200 (39185) | 39185..39478 | - | 294 | WP_016155038.1 | YicS family protein | - |
NFK10_RS00205 (39609) | 39609..40025 | + | 417 | WP_016157796.1 | GNAT family N-acetyltransferase | - |
NFK10_RS00210 (40197) | 40197..41015 | + | 819 | WP_016157795.1 | lipoprotein NlpA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13061.92 Da Isoelectric Point: 5.6550
>T248740 WP_016157800.1 NZ_CP099378:35702-36043 [Citrobacter braakii]
MWEVETTDVFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGNPIRAFFVFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLNK
MWEVETTDVFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGNPIRAFFVFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLNK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L6TVT2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L6TWH1 |