Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4790060..4790820 Replicon chromosome
Accession NZ_CP099377
Organism Citrobacter braakii strain RHB23-SO-C01

Toxin (Protein)


Gene name higB Uniprot ID A0A7L6U900
Locus tag NFK19_RS22760 Protein ID WP_019077936.1
Coordinates 4790060..4790371 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NFK19_RS22765 Protein ID WP_141876133.1
Coordinates 4790368..4790820 (+) Length 151 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK19_RS22730 (4785727) 4785727..4786629 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
NFK19_RS22735 (4786626) 4786626..4787261 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFK19_RS22740 (4787258) 4787258..4788187 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFK19_RS22745 (4788224) 4788224..4788598 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin -
NFK19_RS22750 (4788598) 4788598..4788840 - 243 WP_016155181.1 CopG family transcriptional regulator -
NFK19_RS22755 (4789046) 4789046..4789975 + 930 WP_137351792.1 alpha/beta hydrolase -
NFK19_RS22760 (4790060) 4790060..4790371 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin Toxin
NFK19_RS22765 (4790368) 4790368..4790820 + 453 WP_141876133.1 helix-turn-helix domain-containing protein Antitoxin
NFK19_RS22770 (4790838) 4790838..4791779 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
NFK19_RS22775 (4791824) 4791824..4792261 - 438 WP_149382140.1 D-aminoacyl-tRNA deacylase -
NFK19_RS22780 (4792258) 4792258..4793130 - 873 WP_279266673.1 virulence factor BrkB family protein -
NFK19_RS22785 (4793124) 4793124..4793723 - 600 WP_279266674.1 glucose-1-phosphatase -
NFK19_RS22790 (4793828) 4793828..4794631 - 804 WP_016155173.1 DeoR/GlpR family DNA-binding transcription regulator -
NFK19_RS22795 (4794665) 4794665..4795561 - 897 WP_104651901.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(95-148)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12502.67 Da        Isoelectric Point: 9.9988

>T248739 WP_019077936.1 NZ_CP099377:4790060-4790371 [Citrobacter braakii]
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE

Download         Length: 312 bp

Antitoxin


Download         Length: 151 a.a.        Molecular weight: 16998.39 Da        Isoelectric Point: 5.9259

>AT248739 WP_141876133.1 NZ_CP099377:4790368-4790820 [Citrobacter braakii]
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNETEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE

Download         Length: 453 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6U900

Antitoxin

Source ID Structure

References