Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1943979..1944639 | Replicon | chromosome |
Accession | NZ_CP099376 | ||
Organism | Citrobacter braakii strain RHB23-SO-C04 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2I8S535 |
Locus tag | NFK21_RS09170 | Protein ID | WP_053390179.1 |
Coordinates | 1944286..1944639 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFK21_RS09165 | Protein ID | WP_053390178.1 |
Coordinates | 1943979..1944281 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK21_RS09155 (1940499) | 1940499..1941761 | + | 1263 | WP_181545753.1 | integrase arm-type DNA-binding domain-containing protein | - |
NFK21_RS09160 (1942593) | 1942593..1943480 | - | 888 | WP_103283719.1 | integrase domain-containing protein | - |
NFK21_RS09165 (1943979) | 1943979..1944281 | - | 303 | WP_053390178.1 | XRE family transcriptional regulator | Antitoxin |
NFK21_RS09170 (1944286) | 1944286..1944639 | - | 354 | WP_053390179.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFK21_RS09175 (1945138) | 1945138..1945359 | - | 222 | WP_279266948.1 | helix-turn-helix transcriptional regulator | - |
NFK21_RS09180 (1945356) | 1945356..1945823 | - | 468 | WP_200013604.1 | hypothetical protein | - |
NFK21_RS09185 (1946189) | 1946189..1948144 | + | 1956 | WP_279266949.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13442.36 Da Isoelectric Point: 9.0134
>T248719 WP_053390179.1 NZ_CP099376:c1944639-1944286 [Citrobacter braakii]
VWTIKTTDMFDHWFSSLNDIDRASVLAALLVLREKGPGLSRPYADTLRGSRFSNMKELRIQSRGDPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMIPVADREFTNWLNTIKEKE
VWTIKTTDMFDHWFSSLNDIDRASVLAALLVLREKGPGLSRPYADTLRGSRFSNMKELRIQSRGDPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMIPVADREFTNWLNTIKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|