Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5070243..5070842 | Replicon | chromosome |
Accession | NZ_CP099373 | ||
Organism | Citrobacter portucalensis strain RHB38-SO-C05 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NFK58_RS24370 | Protein ID | WP_079939298.1 |
Coordinates | 5070531..5070842 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFK58_RS24365 | Protein ID | WP_079939299.1 |
Coordinates | 5070243..5070530 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK58_RS24350 (NFK58_24370) | 5067739..5068641 | + | 903 | WP_042313505.1 | formate dehydrogenase O subunit beta | - |
NFK58_RS24355 (NFK58_24375) | 5068638..5069273 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFK58_RS24360 (NFK58_24380) | 5069270..5070199 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
NFK58_RS24365 (NFK58_24385) | 5070243..5070530 | - | 288 | WP_079939299.1 | NadS family protein | Antitoxin |
NFK58_RS24370 (NFK58_24390) | 5070531..5070842 | - | 312 | WP_079939298.1 | toxin HigB-2 | Toxin |
NFK58_RS24375 (NFK58_24395) | 5071062..5071970 | + | 909 | WP_191227953.1 | alpha/beta hydrolase | - |
NFK58_RS24380 (NFK58_24400) | 5072035..5072277 | + | 243 | WP_003825282.1 | type II toxin-antitoxin system ParD family antitoxin | - |
NFK58_RS24385 (NFK58_24405) | 5072270..5072626 | + | 357 | WP_249418773.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NFK58_RS24390 (NFK58_24410) | 5072563..5073504 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
NFK58_RS24395 (NFK58_24415) | 5073549..5073986 | - | 438 | WP_003825289.1 | D-aminoacyl-tRNA deacylase | - |
NFK58_RS24400 (NFK58_24420) | 5073983..5074855 | - | 873 | WP_079939294.1 | virulence factor BrkB family protein | - |
NFK58_RS24405 (NFK58_24425) | 5074849..5075448 | - | 600 | WP_123269190.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12261.38 Da Isoelectric Point: 10.0972
>T248689 WP_079939298.1 NZ_CP099373:c5070842-5070531 [Citrobacter portucalensis]
MLFIETEIFTEDVKKLLDDDEYRRLQIFLAIQPDCGDLIQDTGGLRKVRWRARGKGKRSGVRIIYFHQIRKSQIRLLLIY
QKGIKDDLTPQEKVLLRMLNEGW
MLFIETEIFTEDVKKLLDDDEYRRLQIFLAIQPDCGDLIQDTGGLRKVRWRARGKGKRSGVRIIYFHQIRKSQIRLLLIY
QKGIKDDLTPQEKVLLRMLNEGW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|