Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 46071..46798 Replicon plasmid unnamed1
Accession NZ_CP099371
Organism Citrobacter portucalensis strain RHB40-E3-C01

Toxin (Protein)


Gene name higB Uniprot ID A0A663AUB1
Locus tag NFK62_RS25410 Protein ID WP_000558568.1
Coordinates 46071..46382 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID V0AHC4
Locus tag NFK62_RS25415 Protein ID WP_000990392.1
Coordinates 46379..46798 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK62_RS25385 (NFK62_25375) 41788..42696 - 909 WP_071444874.1 recombination-associated protein RdgC -
NFK62_RS25390 (NFK62_25380) 42763..43419 - 657 WP_240500703.1 phage baseplate assembly protein V -
NFK62_RS25395 (NFK62_25385) 43412..44392 - 981 WP_197385916.1 tail length tape measure protein -
NFK62_RS25400 (NFK62_25390) 44395..45159 - 765 WP_240498904.1 baseplate -
NFK62_RS25405 (NFK62_25395) 45156..45929 - 774 WP_279276000.1 phage tail protein -
NFK62_RS25410 (NFK62_25400) 46071..46382 + 312 WP_000558568.1 type II toxin-antitoxin system HigB family toxin Toxin
NFK62_RS25415 (NFK62_25405) 46379..46798 + 420 WP_000990392.1 helix-turn-helix domain-containing protein Antitoxin
NFK62_RS25420 (NFK62_25410) 46835..48037 - 1203 WP_071444878.1 phage tail protein -
NFK62_RS25425 (NFK62_25415) 48030..48359 - 330 WP_000121260.1 hypothetical protein -
NFK62_RS25430 (NFK62_25420) 48356..49015 - 660 WP_186805022.1 maturation control protein -
NFK62_RS25435 (NFK62_25425) 49269..49406 + 138 WP_165612481.1 hypothetical protein -
NFK62_RS25440 (NFK62_25430) 49378..49608 + 231 WP_071444879.1 hypothetical protein -
NFK62_RS25445 (NFK62_25435) 49855..50493 - 639 WP_071444881.1 Ref family recombination enhancement nuclease -
NFK62_RS25450 (NFK62_25440) 50639..51079 + 441 WP_071444882.1 hypothetical protein -
NFK62_RS25455 (NFK62_25445) 51102..51593 + 492 WP_071444883.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..84106 84106


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(20-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(83-136)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12372.11 Da        Isoelectric Point: 10.0935

>T248674 WP_000558568.1 NZ_CP099371:46071-46382 [Citrobacter portucalensis]
MHVVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15534.71 Da        Isoelectric Point: 4.4702

>AT248674 WP_000990392.1 NZ_CP099371:46379-46798 [Citrobacter portucalensis]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AUB1

Antitoxin

Source ID Structure
AlphaFold DB V0AHC4

References