Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4698181..4698941 | Replicon | chromosome |
Accession | NZ_CP099366 | ||
Organism | Citrobacter braakii strain RHB41-E2-C02 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NFK67_RS22510 | Protein ID | WP_279267354.1 |
Coordinates | 4698181..4698492 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFK67_RS22515 | Protein ID | WP_094761751.1 |
Coordinates | 4698489..4698941 (+) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK67_RS22480 (NFK67_22465) | 4693848..4694750 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
NFK67_RS22485 (NFK67_22470) | 4694747..4695382 | + | 636 | WP_279267352.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFK67_RS22490 (NFK67_22475) | 4695379..4696308 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
NFK67_RS22495 (NFK67_22480) | 4696345..4696719 | - | 375 | WP_016155182.1 | type II toxin-antitoxin system VapC family toxin | - |
NFK67_RS22500 (NFK67_22485) | 4696719..4696961 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | - |
NFK67_RS22505 (NFK67_22490) | 4697167..4698087 | + | 921 | WP_279267353.1 | alpha/beta hydrolase | - |
NFK67_RS22510 (NFK67_22495) | 4698181..4698492 | + | 312 | WP_279267354.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NFK67_RS22515 (NFK67_22500) | 4698489..4698941 | + | 453 | WP_094761751.1 | helix-turn-helix domain-containing protein | Antitoxin |
NFK67_RS22520 (NFK67_22505) | 4698959..4699900 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
NFK67_RS22525 (NFK67_22510) | 4699945..4700382 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
NFK67_RS22530 (NFK67_22515) | 4700379..4701251 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
NFK67_RS22535 (NFK67_22520) | 4701245..4701844 | - | 600 | WP_016155174.1 | glucose-1-phosphatase | - |
NFK67_RS22540 (NFK67_22525) | 4701949..4702752 | - | 804 | WP_016155173.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NFK67_RS22545 (NFK67_22530) | 4702786..4703682 | - | 897 | WP_019077939.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12528.70 Da Isoelectric Point: 9.9320
>T248654 WP_279267354.1 NZ_CP099366:4698181-4698492 [Citrobacter braakii]
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKYIVHHAEYDRLTTYYRGHKE
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKYIVHHAEYDRLTTYYRGHKE
Download Length: 312 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16968.36 Da Isoelectric Point: 5.9259
>AT248654 WP_094761751.1 NZ_CP099366:4698489-4698941 [Citrobacter braakii]
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNEAEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNEAEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|