Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 598..1325 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP099365 | ||
| Organism | Citrobacter braakii strain RHB44-SE-C08 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A482LZ08 |
| Locus tag | NFL11_RS23810 | Protein ID | WP_045898923.1 |
| Coordinates | 598..909 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NFL11_RS23815 | Protein ID | WP_045898925.1 |
| Coordinates | 906..1325 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL11_RS23810 (NFL11_23800) | 598..909 | + | 312 | WP_045898923.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NFL11_RS23815 (NFL11_23805) | 906..1325 | + | 420 | WP_045898925.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NFL11_RS23820 (NFL11_23810) | 1329..1532 | - | 204 | WP_045898927.1 | hypothetical protein | - |
| NFL11_RS23825 (NFL11_23815) | 1766..2746 | - | 981 | WP_000019403.1 | IS5-like element IS5 family transposase | - |
| NFL11_RS23830 (NFL11_23820) | 2977..3345 | - | 369 | WP_050873693.1 | winged helix-turn-helix domain-containing protein | - |
| NFL11_RS23835 (NFL11_23825) | 3408..4220 | - | 813 | WP_071701345.1 | sulfite exporter TauE/SafE family protein | - |
| NFL11_RS23840 (NFL11_23830) | 4464..4961 | - | 498 | WP_071701346.1 | tyrosine-protein phosphatase | - |
| NFL11_RS23845 (NFL11_23835) | 5160..5585 | - | 426 | WP_279268751.1 | glutaredoxin-dependent arsenate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ugd | 1..91254 | 91254 | |
| - | flank | IS/Tn | - | - | 1766..2746 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12347.07 Da Isoelectric Point: 9.7248
>T248641 WP_045898923.1 NZ_CP099365:598-909 [Citrobacter braakii]
MHVISKEPFEEAAKQYPNDSLAVRALYRLVRETDFSSPAEMRTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKQYPNDSLAVRALYRLVRETDFSSPAEMRTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15432.60 Da Isoelectric Point: 4.2699
>AT248641 WP_045898925.1 NZ_CP099365:906-1325 [Citrobacter braakii]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYLEAIELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEMPV
GVALLRTLIDQYRLSYSDLKEEIGSKSLVSQILSGQRSLTIMHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYLEAIELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEMPV
GVALLRTLIDQYRLSYSDLKEEIGSKSLVSQILSGQRSLTIMHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|