Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4719200..4719799 | Replicon | chromosome |
Accession | NZ_CP099364 | ||
Organism | Citrobacter braakii strain RHB44-SE-C08 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NFL11_RS22945 | Protein ID | WP_279268317.1 |
Coordinates | 4719488..4719799 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFL11_RS22940 | Protein ID | WP_131347314.1 |
Coordinates | 4719200..4719487 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL11_RS22925 (4716696) | 4716696..4717598 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
NFL11_RS22930 (4717595) | 4717595..4718230 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFL11_RS22935 (4718227) | 4718227..4719156 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
NFL11_RS22940 (4719200) | 4719200..4719487 | - | 288 | WP_131347314.1 | helix-turn-helix domain-containing protein | Antitoxin |
NFL11_RS22945 (4719488) | 4719488..4719799 | - | 312 | WP_279268317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFL11_RS22950 (4720020) | 4720020..4720928 | + | 909 | WP_049041381.1 | alpha/beta hydrolase | - |
NFL11_RS22955 (4720993) | 4720993..4721235 | + | 243 | WP_016155179.1 | type II toxin-antitoxin system ParD family antitoxin | - |
NFL11_RS22960 (4721228) | 4721228..4721515 | + | 288 | WP_049269420.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NFL11_RS22965 (4721521) | 4721521..4722462 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
NFL11_RS22970 (4722507) | 4722507..4722944 | - | 438 | WP_279268318.1 | D-aminoacyl-tRNA deacylase | - |
NFL11_RS22975 (4722941) | 4722941..4723813 | - | 873 | WP_109017836.1 | virulence factor BrkB family protein | - |
NFL11_RS22980 (4723807) | 4723807..4724406 | - | 600 | WP_049282314.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12344.51 Da Isoelectric Point: 10.2893
>T248640 WP_279268317.1 NZ_CP099364:c4719799-4719488 [Citrobacter braakii]
MLFIETEIFTEDVKKLLDDDEYRRLQIFLAIQPDCGDLIQETGGLRKVRWRARGKGKRGGVRIIYFHQIRKSQIRLLLIY
QKGIKDDLTPQEKVLLRMLNERW
MLFIETEIFTEDVKKLLDDDEYRRLQIFLAIQPDCGDLIQETGGLRKVRWRARGKGKRGGVRIIYFHQIRKSQIRLLLIY
QKGIKDDLTPQEKVLLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|