Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 69536..69800 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP099359 | ||
| Organism | Escherichia fergusonii strain RHB02-E1-C03 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | NFJ18_RS23235 | Protein ID | WP_001331364.1 |
| Coordinates | 69648..69800 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 69536..69593 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ18_RS23220 (64775) | 64775..67066 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| NFJ18_RS23225 (67059) | 67059..68129 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| NFJ18_RS23230 (68148) | 68148..69356 | - | 1209 | WP_181465534.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (69536) | 69536..69593 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (69536) | 69536..69593 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (69536) | 69536..69593 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (69536) | 69536..69593 | - | 58 | NuclAT_0 | - | Antitoxin |
| NFJ18_RS23235 (69648) | 69648..69800 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| NFJ18_RS23240 (69872) | 69872..70123 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| NFJ18_RS23245 (70624) | 70624..70719 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| NFJ18_RS23250 (70784) | 70784..70960 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| NFJ18_RS23255 (71352) | 71352..71561 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| NFJ18_RS23260 (71633) | 71633..72295 | - | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NFJ18_RS23265 (72360) | 72360..74522 | - | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aadA2 / cmlA1 / ant(3'')-Ia / sul3 | - | 1..116881 | 116881 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T248624 WP_001331364.1 NZ_CP099359:69648-69800 [Escherichia fergusonii]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT248624 NZ_CP099359:c69593-69536 [Escherichia fergusonii]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|