Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 69536..69800 Replicon plasmid unnamed1
Accession NZ_CP099359
Organism Escherichia fergusonii strain RHB02-E1-C03

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag NFJ18_RS23235 Protein ID WP_001331364.1
Coordinates 69648..69800 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 69536..69593 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ18_RS23220 (64775) 64775..67066 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
NFJ18_RS23225 (67059) 67059..68129 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
NFJ18_RS23230 (68148) 68148..69356 - 1209 WP_181465534.1 IncI1-type conjugal transfer protein TrbA -
- (69536) 69536..69593 - 58 NuclAT_0 - Antitoxin
- (69536) 69536..69593 - 58 NuclAT_0 - Antitoxin
- (69536) 69536..69593 - 58 NuclAT_0 - Antitoxin
- (69536) 69536..69593 - 58 NuclAT_0 - Antitoxin
NFJ18_RS23235 (69648) 69648..69800 + 153 WP_001331364.1 Hok/Gef family protein Toxin
NFJ18_RS23240 (69872) 69872..70123 - 252 WP_001291965.1 hypothetical protein -
NFJ18_RS23245 (70624) 70624..70719 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
NFJ18_RS23250 (70784) 70784..70960 - 177 WP_001054904.1 hypothetical protein -
NFJ18_RS23255 (71352) 71352..71561 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
NFJ18_RS23260 (71633) 71633..72295 - 663 WP_000653334.1 plasmid IncI1-type surface exclusion protein ExcA -
NFJ18_RS23265 (72360) 72360..74522 - 2163 WP_000698351.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aadA2 / cmlA1 / ant(3'')-Ia / sul3 - 1..116881 116881


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T248624 WP_001331364.1 NZ_CP099359:69648-69800 [Escherichia fergusonii]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT248624 NZ_CP099359:c69593-69536 [Escherichia fergusonii]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References