Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4302948..4303206 | Replicon | chromosome |
Accession | NZ_CP099358 | ||
Organism | Escherichia fergusonii strain RHB02-E1-C03 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | - |
Locus tag | NFJ18_RS20780 | Protein ID | WP_181202950.1 |
Coordinates | 4302948..4303100 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 4303151..4303206 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ18_RS20750 | 4298812..4299522 | - | 711 | WP_000190514.1 | DUF3053 domain-containing protein | - |
NFJ18_RS20755 | 4299960..4301330 | + | 1371 | WP_000184983.1 | MFS transporter | - |
NFJ18_RS20760 | 4301580..4301870 | + | 291 | WP_000455800.1 | HTH-type transcriptional regulator | - |
NFJ18_RS20765 | 4302152..4302364 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
NFJ18_RS20770 | 4302418..4302789 | - | 372 | WP_001037803.1 | membrane protein insertion efficiency factor YidD | - |
NFJ18_RS20775 | 4302900..4302971 | + | 72 | WP_216665726.1 | hypothetical protein | - |
NFJ18_RS20780 | 4302948..4303100 | - | 153 | WP_181202950.1 | type I toxin-antitoxin system toxin HokA | Toxin |
- | 4303151..4303206 | + | 56 | - | - | Antitoxin |
NFJ18_RS20785 | 4303401..4303760 | - | 360 | WP_141095883.1 | hypothetical protein | - |
NFJ18_RS20790 | 4303829..4305898 | - | 2070 | WP_001291786.1 | glycine--tRNA ligase subunit beta | - |
NFJ18_RS20795 | 4305908..4306819 | - | 912 | WP_181202951.1 | glycine--tRNA ligase subunit alpha | - |
NFJ18_RS20800 | 4306915..4307214 | - | 300 | WP_024256552.1 | YsaB family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5926.17 Da Isoelectric Point: 6.9160
>T248622 WP_181202950.1 NZ_CP099358:c4303100-4302948 [Escherichia fergusonii]
MPQKYGLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
MPQKYGLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
Download Length: 153 bp
Antitoxin
Download Length: 56 bp
>AT248622 NZ_CP099358:4303151-4303206 [Escherichia fergusonii]
GTTGAAGCATAGAGGCAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTGAAGCATAGAGGCAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|