Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokX/Ldr(toxin)
Location 4273587..4273806 Replicon chromosome
Accession NZ_CP099358
Organism Escherichia fergusonii strain RHB02-E1-C03

Toxin (Protein)


Gene name ldrD Uniprot ID -
Locus tag NFJ18_RS20635 Protein ID WP_181202942.1
Coordinates 4273587..4273694 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokX
Locus tag -
Coordinates 4273743..4273806 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ18_RS20605 (4268637) 4268637..4268825 - 189 WP_001063310.1 cellulose biosynthesis protein BcsR -
NFJ18_RS20610 (4269112) 4269112..4270671 + 1560 WP_001070267.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
NFJ18_RS20615 (4270668) 4270668..4270859 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
NFJ18_RS20620 (4270856) 4270856..4272535 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
NFJ18_RS20625 (4272622) 4272622..4272729 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4272787) 4272787..4272841 + 55 NuclAT_23 - -
- (4272787) 4272787..4272841 + 55 NuclAT_23 - -
- (4272787) 4272787..4272841 + 55 NuclAT_23 - -
- (4272787) 4272787..4272841 + 55 NuclAT_23 - -
- (4272787) 4272787..4272841 + 55 NuclAT_26 - -
- (4272787) 4272787..4272841 + 55 NuclAT_26 - -
- (4272787) 4272787..4272841 + 55 NuclAT_26 - -
- (4272787) 4272787..4272841 + 55 NuclAT_26 - -
- (4272787) 4272787..4272841 + 55 NuclAT_29 - -
- (4272787) 4272787..4272841 + 55 NuclAT_29 - -
- (4272787) 4272787..4272841 + 55 NuclAT_29 - -
- (4272787) 4272787..4272841 + 55 NuclAT_29 - -
- (4272787) 4272787..4272841 + 55 NuclAT_32 - -
- (4272787) 4272787..4272841 + 55 NuclAT_32 - -
- (4272787) 4272787..4272841 + 55 NuclAT_32 - -
- (4272787) 4272787..4272841 + 55 NuclAT_32 - -
- (4272787) 4272787..4272843 + 57 NuclAT_17 - -
- (4272787) 4272787..4272843 + 57 NuclAT_17 - -
- (4272787) 4272787..4272843 + 57 NuclAT_17 - -
- (4272787) 4272787..4272843 + 57 NuclAT_17 - -
- (4272787) 4272787..4272843 + 57 NuclAT_20 - -
- (4272787) 4272787..4272843 + 57 NuclAT_20 - -
- (4272787) 4272787..4272843 + 57 NuclAT_20 - -
- (4272787) 4272787..4272843 + 57 NuclAT_20 - -
NFJ18_RS20630 (4273105) 4273105..4273212 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4273261) 4273261..4273324 + 64 NuclAT_22 - -
- (4273261) 4273261..4273324 + 64 NuclAT_22 - -
- (4273261) 4273261..4273324 + 64 NuclAT_22 - -
- (4273261) 4273261..4273324 + 64 NuclAT_22 - -
- (4273261) 4273261..4273324 + 64 NuclAT_25 - -
- (4273261) 4273261..4273324 + 64 NuclAT_25 - -
- (4273261) 4273261..4273324 + 64 NuclAT_25 - -
- (4273261) 4273261..4273324 + 64 NuclAT_25 - -
- (4273261) 4273261..4273324 + 64 NuclAT_28 - -
- (4273261) 4273261..4273324 + 64 NuclAT_28 - -
- (4273261) 4273261..4273324 + 64 NuclAT_28 - -
- (4273261) 4273261..4273324 + 64 NuclAT_28 - -
- (4273261) 4273261..4273324 + 64 NuclAT_31 - -
- (4273261) 4273261..4273324 + 64 NuclAT_31 - -
- (4273261) 4273261..4273324 + 64 NuclAT_31 - -
- (4273261) 4273261..4273324 + 64 NuclAT_31 - -
- (4273261) 4273261..4273326 + 66 NuclAT_16 - -
- (4273261) 4273261..4273326 + 66 NuclAT_16 - -
- (4273261) 4273261..4273326 + 66 NuclAT_16 - -
- (4273261) 4273261..4273326 + 66 NuclAT_16 - -
- (4273261) 4273261..4273326 + 66 NuclAT_19 - -
- (4273261) 4273261..4273326 + 66 NuclAT_19 - -
- (4273261) 4273261..4273326 + 66 NuclAT_19 - -
- (4273261) 4273261..4273326 + 66 NuclAT_19 - -
NFJ18_RS20635 (4273587) 4273587..4273694 - 108 WP_181202942.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4273743) 4273743..4273806 + 64 NuclAT_21 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_21 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_21 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_21 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_24 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_24 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_24 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_24 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_27 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_27 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_27 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_27 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_30 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_30 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_30 - Antitoxin
- (4273743) 4273743..4273806 + 64 NuclAT_30 - Antitoxin
- (4273743) 4273743..4273808 + 66 NuclAT_15 - -
- (4273743) 4273743..4273808 + 66 NuclAT_15 - -
- (4273743) 4273743..4273808 + 66 NuclAT_15 - -
- (4273743) 4273743..4273808 + 66 NuclAT_15 - -
- (4273743) 4273743..4273808 + 66 NuclAT_18 - -
- (4273743) 4273743..4273808 + 66 NuclAT_18 - -
- (4273743) 4273743..4273808 + 66 NuclAT_18 - -
- (4273743) 4273743..4273808 + 66 NuclAT_18 - -
NFJ18_RS20640 (4274131) 4274131..4275327 + 1197 WP_181202943.1 methionine gamma-lyase -
NFJ18_RS20645 (4275576) 4275576..4276873 + 1298 Protein_4029 transporter -
NFJ18_RS20650 (4276889) 4276889..4278100 - 1212 WP_181202945.1 sigma 54-interacting transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-34)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3850.60 Da        Isoelectric Point: 7.0027

>T248620 WP_181202942.1 NZ_CP099358:c4273694-4273587 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRN

Download         Length: 108 bp

Antitoxin


Download         Length: 64 bp

>AT248620 NZ_CP099358:4273743-4273806 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References