Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2208945..2209507 | Replicon | chromosome |
Accession | NZ_CP099358 | ||
Organism | Escherichia fergusonii strain RHB02-E1-C03 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NFJ18_RS10860 | Protein ID | WP_104919749.1 |
Coordinates | 2209229..2209507 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1PAQ1 |
Locus tag | NFJ18_RS10855 | Protein ID | WP_000781370.1 |
Coordinates | 2208945..2209229 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ18_RS10840 (2204304) | 2204304..2207351 | + | 3048 | WP_015953395.1 | formate dehydrogenase-N subunit alpha | - |
NFJ18_RS10845 (2207364) | 2207364..2208248 | + | 885 | WP_001240580.1 | formate dehydrogenase N subunit beta | - |
NFJ18_RS10850 (2208241) | 2208241..2208894 | + | 654 | WP_000045648.1 | formate dehydrogenase-N subunit gamma | - |
NFJ18_RS10855 (2208945) | 2208945..2209229 | - | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
NFJ18_RS10860 (2209229) | 2209229..2209507 | - | 279 | WP_104919749.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ18_RS10865 (2209693) | 2209693..2210703 | - | 1011 | WP_000642407.1 | alcohol dehydrogenase AdhP | - |
NFJ18_RS10870 (2210837) | 2210837..2212534 | - | 1698 | WP_181203469.1 | malate dehydrogenase | - |
NFJ18_RS10875 (2212691) | 2212691..2212828 | - | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
NFJ18_RS10880 (2212930) | 2212930..2213145 | - | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
NFJ18_RS10885 (2213487) | 2213487..2213918 | + | 432 | WP_000152305.1 | peroxiredoxin OsmC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10521.10 Da Isoelectric Point: 7.3562
>T248615 WP_104919749.1 NZ_CP099358:c2209507-2209229 [Escherichia fergusonii]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASCLADLDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASCLADLDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2ICT | |
PDB | 2ICP | |
AlphaFold DB | A0A829CUG6 |