Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 1104761..1105440 | Replicon | chromosome |
Accession | NZ_CP099358 | ||
Organism | Escherichia fergusonii strain RHB02-E1-C03 |
Toxin (Protein)
Gene name | higB | Uniprot ID | B7LJF3 |
Locus tag | NFJ18_RS05465 | Protein ID | WP_002431667.1 |
Coordinates | 1104761..1105063 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFJ18_RS05470 | Protein ID | WP_000806441.1 |
Coordinates | 1105099..1105440 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ18_RS05440 (1100137) | 1100137..1101789 | + | 1653 | WP_181203208.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
NFJ18_RS05445 (1101827) | 1101827..1102330 | - | 504 | WP_000667001.1 | hypothetical protein | - |
NFJ18_RS05450 (1102327) | 1102327..1102983 | - | 657 | WP_181674165.1 | hypothetical protein | - |
NFJ18_RS05455 (1103151) | 1103151..1103630 | - | 480 | WP_181203209.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
NFJ18_RS05460 (1103834) | 1103834..1104628 | - | 795 | WP_000365145.1 | TraB/GumN family protein | - |
NFJ18_RS05465 (1104761) | 1104761..1105063 | + | 303 | WP_002431667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ18_RS05470 (1105099) | 1105099..1105440 | + | 342 | WP_000806441.1 | HigA family addiction module antitoxin | Antitoxin |
NFJ18_RS05475 (1105554) | 1105554..1108058 | - | 2505 | WP_000083966.1 | copper-exporting P-type ATPase CopA | - |
NFJ18_RS05480 (1108365) | 1108365..1109654 | + | 1290 | WP_000102764.1 | APC family permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11811.37 Da Isoelectric Point: 10.1572
>T248609 WP_002431667.1 NZ_CP099358:1104761-1105063 [Escherichia fergusonii]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELYLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELYLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|