Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 870276..870522 | Replicon | chromosome |
Accession | NZ_CP099358 | ||
Organism | Escherichia fergusonii strain RHB02-E1-C03 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | NFJ18_RS04245 | Protein ID | WP_000956458.1 |
Coordinates | 870370..870522 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 870276..870328 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ18_RS04230 | 865784..867583 | + | 1800 | WP_181203169.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
NFJ18_RS04235 | 867583..869295 | + | 1713 | WP_115738177.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
NFJ18_RS04240 | 869369..870103 | + | 735 | WP_181203170.1 | phosphoadenosine phosphosulfate reductase | - |
- | 870276..870328 | - | 53 | - | - | Antitoxin |
NFJ18_RS04245 | 870370..870522 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
NFJ18_RS04250 | 870715..873415 | + | 2701 | Protein_819 | CRISPR-associated helicase Cas3' | - |
NFJ18_RS04255 | 873513..875075 | + | 1563 | WP_181203171.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T248608 WP_000956458.1 NZ_CP099358:870370-870522 [Escherichia fergusonii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT248608 NZ_CP099358:c870328-870276 [Escherichia fergusonii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|