Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 568911..569169 | Replicon | chromosome |
Accession | NZ_CP099358 | ||
Organism | Escherichia fergusonii strain RHB02-E1-C03 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | NFJ18_RS02875 | Protein ID | WP_000809168.1 |
Coordinates | 568911..569063 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 569112..569169 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ18_RS02855 | 563977..564564 | + | 588 | WP_002431696.1 | molybdopterin adenylyltransferase | - |
NFJ18_RS02860 | 564598..565164 | - | 567 | WP_000528529.1 | acetate uptake transporter | - |
NFJ18_RS02865 | 565672..567588 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
NFJ18_RS02870 | 567677..568807 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
NFJ18_RS02875 | 568911..569063 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 569112..569169 | + | 58 | - | - | Antitoxin |
NFJ18_RS02880 | 569604..570770 | + | 1167 | WP_000681374.1 | Na+/H+ antiporter NhaA | - |
NFJ18_RS02885 | 570838..571737 | + | 900 | WP_000019049.1 | transcriptional activator NhaR | - |
NFJ18_RS02890 | 571833..572096 | - | 264 | WP_001274021.1 | 30S ribosomal protein S20 | - |
NFJ18_RS02895 | 572199..572417 | + | 219 | WP_181203115.1 | DUF2575 domain-containing protein | - |
NFJ18_RS02900 | 572425..573366 | + | 942 | WP_000767329.1 | bifunctional riboflavin kinase/FAD synthetase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T248607 WP_000809168.1 NZ_CP099358:c569063-568911 [Escherichia fergusonii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT248607 NZ_CP099358:569112-569169 [Escherichia fergusonii]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|