Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 437820..438619 | Replicon | chromosome |
| Accession | NZ_CP099358 | ||
| Organism | Escherichia fergusonii strain RHB02-E1-C03 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F0JQM9 |
| Locus tag | NFJ18_RS02105 | Protein ID | WP_000347270.1 |
| Coordinates | 437820..438284 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | NFJ18_RS02110 | Protein ID | WP_104919918.1 |
| Coordinates | 438284..438619 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ18_RS02075 (432821) | 432821..433255 | - | 435 | WP_032303830.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NFJ18_RS02080 (433273) | 433273..434151 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NFJ18_RS02085 (434141) | 434141..434920 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NFJ18_RS02090 (434931) | 434931..435404 | - | 474 | WP_032303829.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NFJ18_RS02095 (435427) | 435427..436707 | - | 1281 | WP_181203097.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NFJ18_RS02100 (436956) | 436956..437765 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NFJ18_RS02105 (437820) | 437820..438284 | - | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NFJ18_RS02110 (438284) | 438284..438619 | - | 336 | WP_104919918.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NFJ18_RS02115 (438768) | 438768..440339 | - | 1572 | WP_181203098.1 | galactarate dehydratase | - |
| NFJ18_RS02120 (440810) | 440810..441580 | + | 771 | WP_001058567.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NFJ18_RS02125 (441605) | 441605..442495 | + | 891 | WP_000178100.1 | 2-hydroxy-3-oxopropionate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T248606 WP_000347270.1 NZ_CP099358:c438284-437820 [Escherichia fergusonii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|