Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 676777..677035 | Replicon | chromosome |
| Accession | NZ_CP099351 | ||
| Organism | Escherichia marmotae strain RHB02-E4-C07 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | NFJ26_RS03150 | Protein ID | WP_000809168.1 |
| Coordinates | 676777..676929 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 676978..677035 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ26_RS03120 | 671955..672053 | - | 99 | Protein_601 | hypothetical protein | - |
| NFJ26_RS03125 | 672102..672668 | - | 567 | WP_000528538.1 | acetate uptake transporter | - |
| NFJ26_RS03130 | 672817..672930 | - | 114 | Protein_603 | hypothetical protein | - |
| NFJ26_RS03135 | 672941..673160 | - | 220 | Protein_604 | DUF2541 family protein | - |
| NFJ26_RS03140 | 673537..675453 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| NFJ26_RS03145 | 675542..676672 | + | 1131 | WP_001118463.1 | molecular chaperone DnaJ | - |
| NFJ26_RS03150 | 676777..676929 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 676978..677035 | + | 58 | - | - | Antitoxin |
| NFJ26_RS03155 | 677513..678679 | + | 1167 | WP_000681378.1 | Na+/H+ antiporter NhaA | - |
| NFJ26_RS03160 | 678739..679644 | + | 906 | WP_000062876.1 | transcriptional activator NhaR | - |
| NFJ26_RS03165 | 679747..680010 | - | 264 | WP_001274018.1 | 30S ribosomal protein S20 | - |
| NFJ26_RS03170 | 680113..680331 | + | 219 | Protein_611 | DUF2575 domain-containing protein | - |
| NFJ26_RS03175 | 680339..681280 | + | 942 | WP_000767344.1 | bifunctional riboflavin kinase/FAD synthetase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T248593 WP_000809168.1 NZ_CP099351:c676929-676777 [Escherichia marmotae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT248593 NZ_CP099351:676978-677035 [Escherichia marmotae]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|