Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 4035705..4036384 | Replicon | chromosome |
Accession | NZ_CP099349 | ||
Organism | Escherichia fergusonii strain RHB16-E2-C07 |
Toxin (Protein)
Gene name | higB | Uniprot ID | B7LJF3 |
Locus tag | NFJ86_RS19520 | Protein ID | WP_002431667.1 |
Coordinates | 4035705..4036007 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFJ86_RS19525 | Protein ID | WP_000806441.1 |
Coordinates | 4036043..4036384 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ86_RS19495 (4031081) | 4031081..4032733 | + | 1653 | WP_181203208.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
NFJ86_RS19500 (4032771) | 4032771..4033274 | - | 504 | WP_000667001.1 | hypothetical protein | - |
NFJ86_RS19505 (4033271) | 4033271..4033927 | - | 657 | WP_181674165.1 | hypothetical protein | - |
NFJ86_RS19510 (4034095) | 4034095..4034574 | - | 480 | WP_181203209.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
NFJ86_RS19515 (4034778) | 4034778..4035572 | - | 795 | WP_000365145.1 | TraB/GumN family protein | - |
NFJ86_RS19520 (4035705) | 4035705..4036007 | + | 303 | WP_002431667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ86_RS19525 (4036043) | 4036043..4036384 | + | 342 | WP_000806441.1 | HigA family addiction module antitoxin | Antitoxin |
NFJ86_RS19530 (4036498) | 4036498..4039002 | - | 2505 | WP_000083966.1 | copper-exporting P-type ATPase CopA | - |
NFJ86_RS19535 (4039309) | 4039309..4040598 | + | 1290 | WP_000102764.1 | APC family permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11811.37 Da Isoelectric Point: 10.1572
>T248587 WP_002431667.1 NZ_CP099349:4035705-4036007 [Escherichia fergusonii]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELYLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELYLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|