Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3826479..3826725 | Replicon | chromosome |
Accession | NZ_CP099349 | ||
Organism | Escherichia fergusonii strain RHB16-E2-C07 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | NFJ86_RS18465 | Protein ID | WP_000956458.1 |
Coordinates | 3826573..3826725 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 3826479..3826531 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ86_RS18450 | 3821987..3823786 | + | 1800 | WP_181203169.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
NFJ86_RS18455 | 3823786..3825498 | + | 1713 | WP_115738177.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
NFJ86_RS18460 | 3825572..3826306 | + | 735 | WP_046083134.1 | phosphoadenosine phosphosulfate reductase | - |
- | 3826479..3826531 | - | 53 | - | - | Antitoxin |
NFJ86_RS18465 | 3826573..3826725 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
NFJ86_RS18470 | 3826918..3828030 | - | 1113 | WP_001300563.1 | IS4-like element IS421 family transposase | - |
NFJ86_RS18475 | 3828267..3830967 | + | 2701 | Protein_3597 | CRISPR-associated helicase Cas3' | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T248586 WP_000956458.1 NZ_CP099349:3826573-3826725 [Escherichia fergusonii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT248586 NZ_CP099349:c3826531-3826479 [Escherichia fergusonii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|