Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3438627..3439426 | Replicon | chromosome |
| Accession | NZ_CP099349 | ||
| Organism | Escherichia fergusonii strain RHB16-E2-C07 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F0JQM9 |
| Locus tag | NFJ86_RS16625 | Protein ID | WP_000347270.1 |
| Coordinates | 3438627..3439091 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | NFJ86_RS16630 | Protein ID | WP_104919918.1 |
| Coordinates | 3439091..3439426 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ86_RS16595 (3433628) | 3433628..3434062 | - | 435 | WP_032303830.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NFJ86_RS16600 (3434080) | 3434080..3434958 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NFJ86_RS16605 (3434948) | 3434948..3435727 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NFJ86_RS16610 (3435738) | 3435738..3436211 | - | 474 | WP_032303829.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NFJ86_RS16615 (3436234) | 3436234..3437514 | - | 1281 | WP_181203097.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NFJ86_RS16620 (3437763) | 3437763..3438572 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NFJ86_RS16625 (3438627) | 3438627..3439091 | - | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NFJ86_RS16630 (3439091) | 3439091..3439426 | - | 336 | WP_104919918.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NFJ86_RS16635 (3439575) | 3439575..3441146 | - | 1572 | WP_181668631.1 | galactarate dehydratase | - |
| NFJ86_RS16640 (3441617) | 3441617..3442387 | + | 771 | WP_001058567.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NFJ86_RS16645 (3442412) | 3442412..3443302 | + | 891 | WP_000178100.1 | 2-hydroxy-3-oxopropionate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T248584 WP_000347270.1 NZ_CP099349:c3439091-3438627 [Escherichia fergusonii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|