Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2610819..2611077 | Replicon | chromosome |
Accession | NZ_CP099349 | ||
Organism | Escherichia fergusonii strain RHB16-E2-C07 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | - |
Locus tag | NFJ86_RS12730 | Protein ID | WP_181202950.1 |
Coordinates | 2610819..2610971 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 2611022..2611077 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ86_RS12700 | 2606683..2607393 | - | 711 | WP_000190514.1 | DUF3053 domain-containing protein | - |
NFJ86_RS12705 | 2607831..2609201 | + | 1371 | WP_000184983.1 | MFS transporter | - |
NFJ86_RS12710 | 2609451..2609741 | + | 291 | WP_000455800.1 | HTH-type transcriptional regulator | - |
NFJ86_RS12715 | 2610023..2610235 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
NFJ86_RS12720 | 2610289..2610660 | - | 372 | WP_001037803.1 | membrane protein insertion efficiency factor YidD | - |
NFJ86_RS12725 | 2610771..2610842 | + | 72 | WP_216665726.1 | hypothetical protein | - |
NFJ86_RS12730 | 2610819..2610971 | - | 153 | WP_181202950.1 | type I toxin-antitoxin system toxin HokA | Toxin |
- | 2611022..2611077 | + | 56 | - | - | Antitoxin |
NFJ86_RS12735 | 2611272..2611631 | - | 360 | WP_141095883.1 | hypothetical protein | - |
NFJ86_RS12740 | 2611700..2613769 | - | 2070 | WP_001291786.1 | glycine--tRNA ligase subunit beta | - |
NFJ86_RS12745 | 2613779..2614690 | - | 912 | WP_181202951.1 | glycine--tRNA ligase subunit alpha | - |
NFJ86_RS12750 | 2614786..2615085 | - | 300 | WP_024256552.1 | YsaB family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5926.17 Da Isoelectric Point: 6.9160
>T248582 WP_181202950.1 NZ_CP099349:c2610971-2610819 [Escherichia fergusonii]
MPQKYGLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
MPQKYGLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
Download Length: 153 bp
Antitoxin
Download Length: 56 bp
>AT248582 NZ_CP099349:2611022-2611077 [Escherichia fergusonii]
GTTGAAGCATAGAGGCAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTGAAGCATAGAGGCAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|