Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokX/Ldr(toxin) |
| Location | 2581457..2581676 | Replicon | chromosome |
| Accession | NZ_CP099349 | ||
| Organism | Escherichia fergusonii strain RHB16-E2-C07 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | - |
| Locus tag | NFJ86_RS12585 | Protein ID | WP_181202942.1 |
| Coordinates | 2581457..2581564 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokX | ||
| Locus tag | - | ||
| Coordinates | 2581613..2581676 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ86_RS12555 (2576507) | 2576507..2576695 | - | 189 | WP_001063310.1 | cellulose biosynthesis protein BcsR | - |
| NFJ86_RS12560 (2576982) | 2576982..2578541 | + | 1560 | WP_001070267.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| NFJ86_RS12565 (2578538) | 2578538..2578729 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| NFJ86_RS12570 (2578726) | 2578726..2580405 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| NFJ86_RS12575 (2580492) | 2580492..2580599 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_24 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_24 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_24 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_24 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_27 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_27 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_27 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_27 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_30 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_30 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_30 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_30 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_33 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_33 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_33 | - | - |
| - (2580657) | 2580657..2580711 | + | 55 | NuclAT_33 | - | - |
| - (2580657) | 2580657..2580713 | + | 57 | NuclAT_18 | - | - |
| - (2580657) | 2580657..2580713 | + | 57 | NuclAT_18 | - | - |
| - (2580657) | 2580657..2580713 | + | 57 | NuclAT_18 | - | - |
| - (2580657) | 2580657..2580713 | + | 57 | NuclAT_18 | - | - |
| - (2580657) | 2580657..2580713 | + | 57 | NuclAT_21 | - | - |
| - (2580657) | 2580657..2580713 | + | 57 | NuclAT_21 | - | - |
| - (2580657) | 2580657..2580713 | + | 57 | NuclAT_21 | - | - |
| - (2580657) | 2580657..2580713 | + | 57 | NuclAT_21 | - | - |
| NFJ86_RS12580 (2580975) | 2580975..2581082 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_23 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_23 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_23 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_23 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_26 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_26 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_26 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_26 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_29 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_29 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_29 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_29 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_32 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_32 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_32 | - | - |
| - (2581131) | 2581131..2581194 | + | 64 | NuclAT_32 | - | - |
| - (2581131) | 2581131..2581196 | + | 66 | NuclAT_17 | - | - |
| - (2581131) | 2581131..2581196 | + | 66 | NuclAT_17 | - | - |
| - (2581131) | 2581131..2581196 | + | 66 | NuclAT_17 | - | - |
| - (2581131) | 2581131..2581196 | + | 66 | NuclAT_17 | - | - |
| - (2581131) | 2581131..2581196 | + | 66 | NuclAT_20 | - | - |
| - (2581131) | 2581131..2581196 | + | 66 | NuclAT_20 | - | - |
| - (2581131) | 2581131..2581196 | + | 66 | NuclAT_20 | - | - |
| - (2581131) | 2581131..2581196 | + | 66 | NuclAT_20 | - | - |
| NFJ86_RS12585 (2581457) | 2581457..2581564 | - | 108 | WP_181202942.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_22 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_22 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_22 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_22 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_25 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_25 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_25 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_25 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_28 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_28 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_28 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_28 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_31 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_31 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_31 | - | Antitoxin |
| - (2581613) | 2581613..2581676 | + | 64 | NuclAT_31 | - | Antitoxin |
| - (2581613) | 2581613..2581678 | + | 66 | NuclAT_16 | - | - |
| - (2581613) | 2581613..2581678 | + | 66 | NuclAT_16 | - | - |
| - (2581613) | 2581613..2581678 | + | 66 | NuclAT_16 | - | - |
| - (2581613) | 2581613..2581678 | + | 66 | NuclAT_16 | - | - |
| - (2581613) | 2581613..2581678 | + | 66 | NuclAT_19 | - | - |
| - (2581613) | 2581613..2581678 | + | 66 | NuclAT_19 | - | - |
| - (2581613) | 2581613..2581678 | + | 66 | NuclAT_19 | - | - |
| - (2581613) | 2581613..2581678 | + | 66 | NuclAT_19 | - | - |
| NFJ86_RS12590 (2582001) | 2582001..2583197 | + | 1197 | WP_181202943.1 | methionine gamma-lyase | - |
| NFJ86_RS12595 (2583446) | 2583446..2584744 | + | 1299 | WP_181202944.1 | amino acid permease | - |
| NFJ86_RS12600 (2584760) | 2584760..2585971 | - | 1212 | WP_181202945.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3850.60 Da Isoelectric Point: 7.0027
>T248580 WP_181202942.1 NZ_CP099349:c2581564-2581457 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRN
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRN
Download Length: 108 bp
>T248580 NZ_CP099349:c2581564-2581457 [Escherichia fergusonii]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATCGCTGGCATTCTTGCCAGTTTGAT
CGTGAACTGGCTGAACAAGCGGAACTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATCGCTGGCATTCTTGCCAGTTTGAT
CGTGAACTGGCTGAACAAGCGGAACTAA
Antitoxin
Download Length: 64 bp
>AT248580 NZ_CP099349:2581613-2581676 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|