Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokX/Ldr(toxin)
Location 2581457..2581676 Replicon chromosome
Accession NZ_CP099349
Organism Escherichia fergusonii strain RHB16-E2-C07

Toxin (Protein)


Gene name ldrD Uniprot ID -
Locus tag NFJ86_RS12585 Protein ID WP_181202942.1
Coordinates 2581457..2581564 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokX
Locus tag -
Coordinates 2581613..2581676 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ86_RS12555 (2576507) 2576507..2576695 - 189 WP_001063310.1 cellulose biosynthesis protein BcsR -
NFJ86_RS12560 (2576982) 2576982..2578541 + 1560 WP_001070267.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
NFJ86_RS12565 (2578538) 2578538..2578729 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
NFJ86_RS12570 (2578726) 2578726..2580405 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
NFJ86_RS12575 (2580492) 2580492..2580599 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2580657) 2580657..2580711 + 55 NuclAT_24 - -
- (2580657) 2580657..2580711 + 55 NuclAT_24 - -
- (2580657) 2580657..2580711 + 55 NuclAT_24 - -
- (2580657) 2580657..2580711 + 55 NuclAT_24 - -
- (2580657) 2580657..2580711 + 55 NuclAT_27 - -
- (2580657) 2580657..2580711 + 55 NuclAT_27 - -
- (2580657) 2580657..2580711 + 55 NuclAT_27 - -
- (2580657) 2580657..2580711 + 55 NuclAT_27 - -
- (2580657) 2580657..2580711 + 55 NuclAT_30 - -
- (2580657) 2580657..2580711 + 55 NuclAT_30 - -
- (2580657) 2580657..2580711 + 55 NuclAT_30 - -
- (2580657) 2580657..2580711 + 55 NuclAT_30 - -
- (2580657) 2580657..2580711 + 55 NuclAT_33 - -
- (2580657) 2580657..2580711 + 55 NuclAT_33 - -
- (2580657) 2580657..2580711 + 55 NuclAT_33 - -
- (2580657) 2580657..2580711 + 55 NuclAT_33 - -
- (2580657) 2580657..2580713 + 57 NuclAT_18 - -
- (2580657) 2580657..2580713 + 57 NuclAT_18 - -
- (2580657) 2580657..2580713 + 57 NuclAT_18 - -
- (2580657) 2580657..2580713 + 57 NuclAT_18 - -
- (2580657) 2580657..2580713 + 57 NuclAT_21 - -
- (2580657) 2580657..2580713 + 57 NuclAT_21 - -
- (2580657) 2580657..2580713 + 57 NuclAT_21 - -
- (2580657) 2580657..2580713 + 57 NuclAT_21 - -
NFJ86_RS12580 (2580975) 2580975..2581082 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2581131) 2581131..2581194 + 64 NuclAT_23 - -
- (2581131) 2581131..2581194 + 64 NuclAT_23 - -
- (2581131) 2581131..2581194 + 64 NuclAT_23 - -
- (2581131) 2581131..2581194 + 64 NuclAT_23 - -
- (2581131) 2581131..2581194 + 64 NuclAT_26 - -
- (2581131) 2581131..2581194 + 64 NuclAT_26 - -
- (2581131) 2581131..2581194 + 64 NuclAT_26 - -
- (2581131) 2581131..2581194 + 64 NuclAT_26 - -
- (2581131) 2581131..2581194 + 64 NuclAT_29 - -
- (2581131) 2581131..2581194 + 64 NuclAT_29 - -
- (2581131) 2581131..2581194 + 64 NuclAT_29 - -
- (2581131) 2581131..2581194 + 64 NuclAT_29 - -
- (2581131) 2581131..2581194 + 64 NuclAT_32 - -
- (2581131) 2581131..2581194 + 64 NuclAT_32 - -
- (2581131) 2581131..2581194 + 64 NuclAT_32 - -
- (2581131) 2581131..2581194 + 64 NuclAT_32 - -
- (2581131) 2581131..2581196 + 66 NuclAT_17 - -
- (2581131) 2581131..2581196 + 66 NuclAT_17 - -
- (2581131) 2581131..2581196 + 66 NuclAT_17 - -
- (2581131) 2581131..2581196 + 66 NuclAT_17 - -
- (2581131) 2581131..2581196 + 66 NuclAT_20 - -
- (2581131) 2581131..2581196 + 66 NuclAT_20 - -
- (2581131) 2581131..2581196 + 66 NuclAT_20 - -
- (2581131) 2581131..2581196 + 66 NuclAT_20 - -
NFJ86_RS12585 (2581457) 2581457..2581564 - 108 WP_181202942.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2581613) 2581613..2581676 + 64 NuclAT_22 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_22 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_22 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_22 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_25 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_25 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_25 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_25 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_28 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_28 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_28 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_28 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_31 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_31 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_31 - Antitoxin
- (2581613) 2581613..2581676 + 64 NuclAT_31 - Antitoxin
- (2581613) 2581613..2581678 + 66 NuclAT_16 - -
- (2581613) 2581613..2581678 + 66 NuclAT_16 - -
- (2581613) 2581613..2581678 + 66 NuclAT_16 - -
- (2581613) 2581613..2581678 + 66 NuclAT_16 - -
- (2581613) 2581613..2581678 + 66 NuclAT_19 - -
- (2581613) 2581613..2581678 + 66 NuclAT_19 - -
- (2581613) 2581613..2581678 + 66 NuclAT_19 - -
- (2581613) 2581613..2581678 + 66 NuclAT_19 - -
NFJ86_RS12590 (2582001) 2582001..2583197 + 1197 WP_181202943.1 methionine gamma-lyase -
NFJ86_RS12595 (2583446) 2583446..2584744 + 1299 WP_181202944.1 amino acid permease -
NFJ86_RS12600 (2584760) 2584760..2585971 - 1212 WP_181202945.1 sigma 54-interacting transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-34)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3850.60 Da        Isoelectric Point: 7.0027

>T248580 WP_181202942.1 NZ_CP099349:c2581564-2581457 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRN

Download         Length: 108 bp

>T248580 NZ_CP099349:c2581564-2581457 [Escherichia fergusonii]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATCGCTGGCATTCTTGCCAGTTTGAT
CGTGAACTGGCTGAACAAGCGGAACTAA

Antitoxin


Download         Length: 64 bp

>AT248580 NZ_CP099349:2581613-2581676 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References