Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 31280..31549 Replicon plasmid unnamed2
Accession NZ_CP099346
Organism Escherichia marmotae strain RHB35-E2-C08

Toxin (Protein)


Gene name hok Uniprot ID -
Locus tag NFK54_RS24415 Protein ID WP_001372321.1
Coordinates 31424..31549 (+) Length 42 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 31280..31345 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK54_RS24375 (26299) 26299..26733 - 435 Protein_32 hypothetical protein -
NFK54_RS24380 (26803) 26803..27009 + 207 WP_024195845.1 hypothetical protein -
NFK54_RS24385 (27035) 27035..27574 + 540 WP_045896589.1 single-stranded DNA-binding protein -
NFK54_RS24390 (27631) 27631..27864 + 234 WP_001470808.1 DUF905 domain-containing protein -
NFK54_RS24395 (27928) 27928..29892 + 1965 WP_279283706.1 ParB/RepB/Spo0J family partition protein -
NFK54_RS24400 (29961) 29961..30395 + 435 WP_089587306.1 conjugation system SOS inhibitor PsiB -
NFK54_RS24405 (30392) 30392..31154 + 763 Protein_38 plasmid SOS inhibition protein A -
- (31280) 31280..31345 + 66 NuclAT_1 - -
- (31123) 31123..31347 + 225 NuclAT_0 - -
- (31123) 31123..31347 + 225 NuclAT_0 - -
- (31123) 31123..31347 + 225 NuclAT_0 - -
- (31123) 31123..31347 + 225 NuclAT_0 - -
- (31123) 31123..31347 - 225 NuclAT_0 - -
NFK54_RS24410 (31333) 31333..31482 + 150 Protein_39 plasmid maintenance protein Mok -
NFK54_RS24415 (31424) 31424..31549 + 126 WP_001372321.1 type I toxin-antitoxin system Hok family toxin Toxin
NFK54_RS24420 (31850) 31850..32146 - 297 Protein_41 hypothetical protein -
NFK54_RS24425 (32216) 32216..32422 + 207 WP_127766627.1 single-stranded DNA-binding protein -
NFK54_RS24430 (32446) 32446..32742 + 297 WP_032083169.1 hypothetical protein -
NFK54_RS24435 (32901) 32901..33143 + 243 WP_000540591.1 hypothetical protein -
NFK54_RS24440 (33140) 33140..33259 + 120 Protein_45 class I SAM-dependent methyltransferase -
NFK54_RS24445 (33348) 33348..33764 - 417 Protein_46 hypothetical protein -
NFK54_RS24450 (33834) 33834..34040 + 207 WP_279283664.1 single-stranded DNA-binding protein -
NFK54_RS24455 (34063) 34063..34359 + 297 WP_001272240.1 hypothetical protein -
NFK54_RS24460 (34466) 34466..35287 + 822 WP_001234451.1 DUF932 domain-containing protein -
NFK54_RS24465 (35566) 35566..36018 - 453 WP_024212709.1 transglycosylase SLT domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..72595 72595


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(2-37)


Sequences

Toxin        


Download         Length: 42 a.a.        Molecular weight: 4780.69 Da        Isoelectric Point: 8.5110

>T248569 WP_001372321.1 NZ_CP099346:31424-31549 [Escherichia marmotae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 126 bp

Antitoxin


Download         Length: 66 bp

>AT248569 NZ_CP099346:c31345-31280 [Escherichia marmotae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References