Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 31280..31549 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP099346 | ||
| Organism | Escherichia marmotae strain RHB35-E2-C08 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NFK54_RS24415 | Protein ID | WP_001372321.1 |
| Coordinates | 31424..31549 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 31280..31345 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK54_RS24375 (26299) | 26299..26733 | - | 435 | Protein_32 | hypothetical protein | - |
| NFK54_RS24380 (26803) | 26803..27009 | + | 207 | WP_024195845.1 | hypothetical protein | - |
| NFK54_RS24385 (27035) | 27035..27574 | + | 540 | WP_045896589.1 | single-stranded DNA-binding protein | - |
| NFK54_RS24390 (27631) | 27631..27864 | + | 234 | WP_001470808.1 | DUF905 domain-containing protein | - |
| NFK54_RS24395 (27928) | 27928..29892 | + | 1965 | WP_279283706.1 | ParB/RepB/Spo0J family partition protein | - |
| NFK54_RS24400 (29961) | 29961..30395 | + | 435 | WP_089587306.1 | conjugation system SOS inhibitor PsiB | - |
| NFK54_RS24405 (30392) | 30392..31154 | + | 763 | Protein_38 | plasmid SOS inhibition protein A | - |
| - (31280) | 31280..31345 | + | 66 | NuclAT_1 | - | - |
| - (31123) | 31123..31347 | + | 225 | NuclAT_0 | - | - |
| - (31123) | 31123..31347 | + | 225 | NuclAT_0 | - | - |
| - (31123) | 31123..31347 | + | 225 | NuclAT_0 | - | - |
| - (31123) | 31123..31347 | + | 225 | NuclAT_0 | - | - |
| - (31123) | 31123..31347 | - | 225 | NuclAT_0 | - | - |
| NFK54_RS24410 (31333) | 31333..31482 | + | 150 | Protein_39 | plasmid maintenance protein Mok | - |
| NFK54_RS24415 (31424) | 31424..31549 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NFK54_RS24420 (31850) | 31850..32146 | - | 297 | Protein_41 | hypothetical protein | - |
| NFK54_RS24425 (32216) | 32216..32422 | + | 207 | WP_127766627.1 | single-stranded DNA-binding protein | - |
| NFK54_RS24430 (32446) | 32446..32742 | + | 297 | WP_032083169.1 | hypothetical protein | - |
| NFK54_RS24435 (32901) | 32901..33143 | + | 243 | WP_000540591.1 | hypothetical protein | - |
| NFK54_RS24440 (33140) | 33140..33259 | + | 120 | Protein_45 | class I SAM-dependent methyltransferase | - |
| NFK54_RS24445 (33348) | 33348..33764 | - | 417 | Protein_46 | hypothetical protein | - |
| NFK54_RS24450 (33834) | 33834..34040 | + | 207 | WP_279283664.1 | single-stranded DNA-binding protein | - |
| NFK54_RS24455 (34063) | 34063..34359 | + | 297 | WP_001272240.1 | hypothetical protein | - |
| NFK54_RS24460 (34466) | 34466..35287 | + | 822 | WP_001234451.1 | DUF932 domain-containing protein | - |
| NFK54_RS24465 (35566) | 35566..36018 | - | 453 | WP_024212709.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..72595 | 72595 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T248569 WP_001372321.1 NZ_CP099346:31424-31549 [Escherichia marmotae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT248569 NZ_CP099346:c31345-31280 [Escherichia marmotae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|